KEGG   Azotobacter vinelandii CA6: AvCA6_08700Help
Entry
AvCA6_08700       CDS       T02634                                 

Gene name
xylQ
Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
avd  Azotobacter vinelandii CA6
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:avd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AvCA6_08700 (xylQ)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AvCA6_08700 (xylQ)
   00650 Butanoate metabolism
    AvCA6_08700 (xylQ)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    AvCA6_08700 (xylQ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AvCA6_08700 (xylQ)
   00622 Xylene degradation
    AvCA6_08700 (xylQ)
   00621 Dioxin degradation
    AvCA6_08700 (xylQ)
Enzymes [BR:avd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AvCA6_08700 (xylQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
825554..826510
Genome map
AA seq 318 aa AA seqDB search
MDRTSSRCKVAIIGSGNIGTDLMIKVLRHGRHLEMGAMVGIDPASDGLARAKRLGVATTA
QGVEGLLALPEFKDIGIAFDATSAGAHARHNELLQAHGVKVIDLTPAAIGPYVVPAINLD
AELDAPNINMVTCGGQATIPMVAAVSRVAQVHYAEIVASIASKSAGPGTRANIDEFTETT
SKAIEVIGGARKGKAIIVLNPAEPPLIMRDSVFVLSEVVDRDAIAASVKEMVASVQRYVP
GYRLKQEVQFELIEKPANVPGVGLVSGLKTSIFLEVEGAAHYLPAYAGNLDIMTSAALSC
AERLAERGKVRTLPSALV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtggatagaacatcgtcccgttgcaaggttgcgatcatcggttcgggcaacatcggaacc
gacctcatgatcaaggtgctgcgccatggcaggcacctggaaatgggcgccatggtcggt
atcgacccggcgtccgacggtctggcgcgcgccaagcggctcggcgtcgcgaccactgcg
caaggcgtggaagggctgctggcgctgccggagttcaaggacatcggcatcgccttcgac
gccacctcggccggtgcccacgcccgccacaacgagctgctgcaggcccacggcgtgaag
gtcatcgacctgaccccggcggccatcggcccctacgtggtcccggcgatcaacctggac
gccgaactcgacgcgccgaacatcaacatggtcacctgcggcggccaggccaccatcccg
atggtcgccgcggtgtcccgcgtggcgcaggtccactacgccgagatcgtcgcctcgatc
gccagcaagtcggccggccccggcacccgcgccaacatcgacgagttcaccgaaaccacc
tcgaaggccatcgaggtgatcggcggggcgcgcaagggcaaggcgatcatcgtcctcaac
ccggccgagccgccgctgatcatgcgcgacagcgtgttcgtgctctccgaggtggtcgac
cgggatgccatcgccgccagcgtcaaggagatggtggccagcgtgcagcgctacgtgccg
ggctaccggctcaagcaggaagtgcagttcgaactgatcgagaagccggccaacgtgccc
ggcgtgggtctggtgtcgggcctcaagacctcgatcttcctggaggtggagggtgccgcc
cattacctgccggcctatgcggggaacctcgacatcatgacctcggcggcgctgtcctgc
gccgagcggctggccgaacgaggcaaggtacgcaccctgccttcggcgctggtttga

  All links  
No link information was found.   
DBGET integrated database retrieval system