KEGG   Aeromonas veronii: B565_1880Help
Entry
B565_1880         CDS       T01462                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
avr  Aeromonas veronii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:avr01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:avr00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2101450..2102775)
Genome map
AA seq 441 aa AA seqDB search
MQTLIWKTLSPAQQADVLTRPALSDEADIGAVVRDIIAAVRSRGDEALRELSQRFERAPR
EQLRVSEAEIEAACARLDDGIKSAIEAAIANIRTFHAAQVQQVVRVETQPGVVCELRTQP
ISRVGLYVPGGSAPLPSTVMMLAIPARLAGCREVVLCTPSPASDEILFAARACGVEKVFA
IGGAQAIAAMAYGTESIPKVDKIFGPGNAYVTEAKGQVSRDWRGAAIDMPAGPSEVLVIA
DESANPAFVAADLLSQAEHGPDSQVVLVTTSPLLADAIAGEIKSQLAKLSRRDIAAQALG
SSLVILCDDLAEACAISNAYAPEHLIVQTRAPRDLLDLLENAGSIFLGAWTPESVGDYAS
GTNHTLPTYGYARTCSSLGLADYQRRYTVQELSAEGIRGLGPIVERIAQAEGLDGHKNAV
TLRLNALATAPQPTAQQKDLS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccctgatctggaagaccctctcccccgcccagcaggccgatgtgctgacccga
ccggccttgagtgacgaggccgatattggtgccgtggtgcgggatatcattgcagcggta
cgcagccggggcgatgaggccctgcgcgagctgagccagcgcttcgagcgcgctccccgt
gagcagttgcgcgtcagcgaggccgagattgaagctgcttgcgcgcggctggatgacggc
atcaaaagcgccatcgaagcagcgattgccaatattcgcaccttccacgccgcccaagtg
cagcaggtagtgcgggtagaaacccagcccggggtggtgtgcgagctgcgcacccaaccc
atcagtcgggtcggcctctatgtgccggggggcagcgcaccgctcccctctaccgtgatg
atgctggccattccggcacgcttagccggttgccgtgaagtggtgctctgcaccccgtcc
cccgccagcgacgagatcctgtttgccgcccgcgcctgcggcgtcgagaaggtgttcgcc
atcggcggtgcccaggccatcgccgccatggcttacggcacagaaagcattcccaaggtg
gacaagatcttcggcccgggcaacgcctatgtgaccgaagccaaggggcaggtatcccgc
gactggcgcggcgccgccatcgacatgcccgccggcccctccgaggtgctggtgattgcc
gacgagagcgccaaccccgccttcgtggcagcggatctgctctcccaggccgagcatggc
cccgacagtcaggtagtgctggtgaccacctcgccgctgctggccgatgccatcgctggc
gaaatcaagagccagctggccaagttgagccgccgcgatatcgccgcgcaggcgctcggc
agcagtctggtgatcctctgtgacgatctggccgaagcgtgtgccatctccaacgcctac
gcgccggagcacctgatcgtgcagacccgagccccgcgcgatctgctggacctgcttgaa
aatgccggttccatctttctgggcgcatggacgccggaatcggtcggcgattacgccagc
ggcaccaaccacaccctgcccacctatggctatgcccgcacctgctccagccttggcctt
gccgattatcagcgccgctacacggtgcaggagctgagcgccgaaggtattcgcggcctt
ggccctatagtcgagcgcattgctcaggccgaagggctcgatggccacaaaaatgccgtg
acgctgagattgaatgccttggccaccgcgccccaaccaacagcacagcagaaggatttg
tcatga

DBGET integrated database retrieval system