KEGG   Aeromonas veronii: B565_3521Help
Entry
B565_3521         CDS       T01462                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
avr  Aeromonas veronii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:avr00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:avr00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3951446..3951982)
Genome map
AA seq 178 aa AA seqDB search
MKWFTLLLLLGASAASAACPDYFNVEMRELNNAQRHNLCQLTEGKVVLVVNTASYCGYSG
QFRDLEKLYQSYKDKGLIILGFPSNDFWQEAGNETKTAEVCRRDYGVTFPMFNRVAVRGS
DAVPLFKGLAAAADGDEPNWNFHKYLVGRDGKLIASYGANQNPADDPLKLQITRALGL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggttcactctgttgctgttattgggggccagcgcggcctctgcggcgtgccca
gattatttcaatgtggagatgcgggagctcaacaatgcccagcgccacaacctctgtcag
ctgaccgagggcaaggtggtactggtggtcaataccgcctcctattgcggctacagcggc
cagtttcgcgatctggagaagctctaccagagctacaaggataaggggctgattattctc
ggtttcccctccaacgacttctggcaggaggcgggcaacgagaccaagaccgccgaggta
tgccgccgcgactatggcgtcaccttcccgatgttcaatcgggtagcggtgcggggctcc
gatgcagtgccattgttcaaggggctggcggcggccgctgatggggatgagccgaactgg
aacttccacaagtatctggtggggcgcgatggcaagctgatcgccagctacggcgccaac
cagaatccggctgacgaccccctcaaactgcagatcacccgggcgctggggctctga

DBGET integrated database retrieval system