KEGG   Azospirillum sp. B510: AZL_023470Help
Entry
AZL_023470        CDS       T01169                                 

Definition
protein-glutamate methylesterase, two-component response regulator
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
azl  Azospirillum sp. B510
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:azl02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:azl02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2665910..2666971
Genome map
AA seq 353 aa AA seqDB search
MSRPIRVVIVDDSALMREMLKDILTREPGMEVAGVARDAFEAREVIKATNPDVITLDVEM
PKMDGLSFLEKIMTLRPTPVIMVSSLTSEGSDAAIRALELGAVDCVAKPGGPDGHGFEAT
ALELVSKIRVAATARLTMRRPSPAHGVLPTPRRAGSGKRLIAIGASTGGVERIRDVLATM
PADCPPIVITQHMGPSYVPSFAARLDRLSAPAVRVAAHGDRPAQGLVLIAPGDRHLAILR
DTAGFVCHIQDTPPVSGHRPSVDVLFASVAKAAGGNAVGVILSGMGRDGAIGMKAMLDAG
AFTIGEQESSCVVYGMPRAAREAGAVMVELPLAQIPAEMLRAFDAVGERPRPA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaccgatccgtgtcgtcatcgtcgacgacagcgcgctgatgcgcgagatgctg
aaggacatcctcacccgcgaaccggggatggaggtggccggcgtcgcccgcgacgccttc
gaagcgcgcgaggtcatcaaggccaccaatcccgatgtcatcacgctggatgtcgagatg
cccaagatggacgggctgtccttcctggagaagatcatgaccctgcggccgacgccggtc
atcatggtctcctccctgaccagcgaggggtccgacgccgccatccgcgcgctggaactg
ggggcggtcgactgcgtcgccaagcccggcggccccgacgggcatggcttcgaggcgacg
gcgctggaactggtctccaagatccgcgtcgccgccaccgcccggctgaccatgcgccgc
ccgtcacccgcccatggcgttctgccgacaccgcggcgcgcgggatcgggcaagcggctg
atcgccatcggcgcctcgaccggcggggtggagcgcatccgcgacgtgctggccaccatg
ccggccgactgcccccccatcgtcatcacccagcatatgggccccagctatgtgccgagc
ttcgccgcccggctggaccggctgtcggccccggccgtgcgggtcgccgcccatggcgac
cgccctgcccaggggctggtgctgatcgcccccggagaccgccatctcgccatcctccgc
gacaccgccggcttcgtctgccacatccaggacaccccgcccgtcagcggccaccgccca
tcggtcgatgtgctgttcgcctccgtcgccaaggcggccggcggcaacgcggtcggcgtc
atcctgtccggcatgggccgcgacggcgccatcggcatgaaggcgatgctcgatgccggc
gccttcaccatcggcgagcaggaatcgagctgcgtcgtctacggaatgccgcgcgccgcc
agggaggccggcgcggtcatggtcgagttgccgcttgcccaaatccccgccgagatgctg
cgcgccttcgacgctgtcggcgaacggccccgccccgcctga

DBGET integrated database retrieval system