KEGG   Bacillus atrophaeus 1942: BATR1942_05840Help
Entry
BATR1942_05840    CDS       T01339                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00020  Citrate cycle (TCA cycle)
bae00640  Propanoate metabolism
bae00660  C5-Branched dibasic acid metabolism
bae01100  Metabolic pathways
bae01110  Biosynthesis of secondary metabolites
bae01120  Microbial metabolism in diverse environments
bae01130  Biosynthesis of antibiotics
bae01200  Carbon metabolism
Module
bae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bae_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BATR1942_05840 (sucC)
   00640 Propanoate metabolism
    BATR1942_05840 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BATR1942_05840 (sucC)
Enzymes [BR:bae01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BATR1942_05840 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADP32122
UniProt: A0A0H3E0W3
Position
1138732..1139889
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVERAEGLSSSVYVVKAQIHAGGRGKAGGV
KIAKSKEEVKAYAEELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYVGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIKKVVIDPAVGLQGYQARKIAFSINIPKELVGQAAKF
MLGLYKAFVEKDCSIAEINPLVVTGDGKVMALDAKLNFDSNALYRQKDIMEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGDPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATKQVGLTLPLVVRLEGTNVDLGKKI
LSESGLNITSAESMADGAQKIVSLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgaataccagggaaaagaagtcctcagaaaatacggagtgtctgttcct
gaaggtaaagtggcttttacagcagaagaagcagttgaaagagcggagggcttatcaagc
tcggtttatgtcgtaaaggcgcaaattcatgctggcggtcgaggcaaagctggcggggta
aagattgcgaaatcaaaagaagaagtaaaagcgtatgccgaggagctgttagggaagacg
ctcgttacgcatcaaacaggtccggacggccaagtaataaaacgcttacttattgaagaa
ggatgcgacattaagaaggaatactatgtcggtctcgtgcttgaccgcgctacttcaaga
atcgtactgatggcgtctgaagaaggcggaacggagattgaagaagtagcagagaaaaca
ccggaaaaaatcaagaaagtcgttattgatccggctgtgggactgcaaggctatcaagcg
agaaaaatcgcattttctattaatataccaaaggagcttgtcggacaagctgctaaattt
atgctgggattatataaagcatttgtagagaaagactgttcaattgctgaaattaatccg
cttgttgtgacaggcgacggaaaagtaatggcgcttgatgcgaaattaaactttgacagc
aatgcactatatagacaaaaagatattatggaatatagagatttggacgaagaggatcca
aaggaaattgaagcttctaaatacgatttaagctacatttctctggatggaaatatcggc
tgcatggtaaacggcgccggccttgcgatgtccacaatggatatcattaaacattacggc
ggagatcctgccaacttccttgacgtgggaggcggcgcaactgctgaaaaagtaacggaa
gcattcaaaattattctttccgaccaaaatgtaaaaggaatttttgtcaacattttcgga
ggcattatgaaatgtgacgtcattgcggaaggggttgttgaagcgacgaaacaagtcggt
ttaacattgccgcttgtcgtccgtcttgaaggcacaaacgtagatctagggaagaaaatc
cttagtgaatcaggtttgaatattacatctgcggagtctatggctgacggggcgcagaaa
atcgtatctttagtatag

DBGET integrated database retrieval system