KEGG   Bacillus atrophaeus 1942: BATR1942_18190Help
Entry
BATR1942_18190    CDS       T01339                                 

Definition
(GenBank) putative dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00625  Chloroalkane and chloroalkene degradation
bae00680  Methane metabolism
bae01100  Metabolic pathways
bae01120  Microbial metabolism in diverse environments
bae01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    BATR1942_18190
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BATR1942_18190
Enzymes [BR:bae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BATR1942_18190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_N_assoc FAD_binding_3 FAD_binding_2 PALP FAD_oxidored Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ADP34555
UniProt: A0A0H3E986
Position
complement(3547430..3548641)
Genome map
AA seq 403 aa AA seqDB search
MSANKAVVYKGNGNVAVEDIGYPELILRDGPGVPKANVNRKCEHGVILKVITTNICGSDQ
HMVRGRTTAPEGLVLGHEITGEVIEAGRDVEFIKKGDIVSVPFNIACGRCVMCKTQKTHV
CLNVNPDRPGSAYGYVDMGGWVGGQSEYVMVPYADFQLLVFPDKEQALEKILDLTMLSDI
FPTGFHGAYTAGVQTGSSVYIAGAGPVGLAAAHSAQLLGASTVIVGDLNEDRLAQARSFG
CETVNVQKHDRLGEQIEQILGEPTVDAAVDCVGFEASGHGNQGEAPAAVLNSIMDVTQVG
GSLGIPGLYVTEDPGASDADAKKGSLKIRFGLGWAKAHTFVTGQTPAMKYNRNLMKAILS
GRAQIAKAVNATVISLDDAPKGYSDFDKGAAKKFVIDPHGTLN
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagcgaacaaagcggttgtgtataaaggaaatggaaacgtggcggtggaagacatc
ggatatccggaattaattctgagggacgggcccggcgttccgaaagcaaatgtcaatcgg
aaatgtgagcacggcgtgattctgaaggtcatcaccaccaacatctgcggaagcgatcag
cacatggtgagaggacggacgacagcgccggaaggcttagtgctcggacatgaaatcacc
ggtgaggttattgaagccggccgggatgttgaatttatcaaaaaaggcgacatcgtatcc
gttcccttcaatattgcctgcggacgctgtgtcatgtgcaagacgcagaaaacgcatgtc
tgcctcaacgtaaatccggatcggccgggatcggcttacggctacgttgatatgggcgga
tgggtcggcggacagtcggaatacgtcatggtgccgtacgccgattttcagcttttggta
ttcccggataaagaacaagcattagaaaaaatcctcgatttaacgatgctgtccgatatt
ttcccaaccggatttcacggcgcttatacagcgggtgtccaaaccggatcaagtgtctat
atcgcaggagcgggacctgtcggcttagccgccgcgcactccgcccagcttctcggcgct
tctacagtcattgtcggcgatttgaacgaagacaggctggcacaggcgagaagctttggc
tgtgaaaccgtcaacgtgcaaaaacacgaccgtctaggcgaacaaattgaacagatactc
ggcgaaccgaccgttgatgccgccgtcgattgcgtagggtttgaagcatcgggacacggc
aatcaaggggaagcccccgccgcggtgctgaactccatcatggatgtcacccaggtcggc
ggaagccttggcattccgggcctatatgtcaccgaagacccgggcgcaagcgacgcagac
gccaaaaaaggctcattaaaaatccgattcggtctaggctgggcaaaagcccataccttc
gtcaccggacaaacaccggccatgaagtataaccgcaatctcatgaaagcgatcctgagc
ggcagagcgcaaattgcaaaagccgtcaacgccaccgtcatttctctggacgacgcgcca
aaaggctacagcgactttgacaaaggagcggcgaagaaatttgtgattgatccgcatgga
acgttgaactaa

DBGET integrated database retrieval system