KEGG   Bacillus coagulans 36D1: Bcoa_2097Help
Entry
Bcoa_2097         CDS       T01628                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bag  Bacillus coagulans 36D1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcoa_2097
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcoa_2097
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcoa_2097
Enzymes [BR:bag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcoa_2097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2289705..2290496
Genome map
AA seq 263 aa AA seqDB search
MGKQKLEAQFETVLARGDQAFVPYIMAGDGGMEETEKRLAFLEACGATAIELGIPFSDPV
ADGPVIQAAGLRAFKAGTTMKKVLDHLKAHPRQVPIILMTYFNPVFAYGLEKFAADCANA
GVDGLIIPDLPIEEEEEIAGELAKCGLALIRLAAITSPKDRLEEIASRSDGFLYAVTVTG
TTGTRTNFHDNIEDYLDFLSSISRVPVLAGFGVSSPEQVRRLTRYCSGVVAGSKIIELFQ
HGETEKIRALVESAKQQAAPNQL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaacaaaaattggaagcacagtttgaaacggttcttgcacgcggtgatcaagcg
tttgtcccttatattatggcaggggacggcggaatggaagagacggagaaaaggcttgcg
tttttagaagcttgcggggcaacggcaattgaacttggcattccgttttccgacccggtc
gcagacggcccggtcatccaggcggcaggactccgcgcttttaaggcaggtacgacaatg
aaaaaagtgctggaccatttaaaagcccatccaaggcaagttccgattattctcatgacg
tatttcaacccggtttttgcctacgggctggaaaaatttgcagcagactgcgcgaatgcc
ggtgttgacggactgattattccagatttgcccatcgaggaagaagaggaaattgccgga
gaactggcaaaatgcggcctggcgctcatccggctggctgccattacaagcccgaaagac
cggcttgaggaaatcgcctcccgttcagatgggtttctgtatgctgtcacggtcaccggt
acaaccggcacccgtacaaattttcacgacaatatcgaggattacctggatttcttatca
agcatcagccgggtgcctgttcttgccggctttggcgtttccagcccggagcaggtccgc
cgtttaacccgttactgcagcggcgtggtggccgggagcaaaatcatcgagctcttccag
cacggggaaacggaaaaaatccgcgcgcttgtggaaagcgcaaagcaacaagcagcacca
aaccagctgtaa

DBGET integrated database retrieval system