KEGG   Bacillus coagulans 36D1: Bcoa_2097Help
Entry
Bcoa_2097         CDS       T01628                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bag  Bacillus coagulans 36D1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bag01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bag00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bag00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2289705..2290496
Genome map
AA seq 263 aa AA seqDB search
MGKQKLEAQFETVLARGDQAFVPYIMAGDGGMEETEKRLAFLEACGATAIELGIPFSDPV
ADGPVIQAAGLRAFKAGTTMKKVLDHLKAHPRQVPIILMTYFNPVFAYGLEKFAADCANA
GVDGLIIPDLPIEEEEEIAGELAKCGLALIRLAAITSPKDRLEEIASRSDGFLYAVTVTG
TTGTRTNFHDNIEDYLDFLSSISRVPVLAGFGVSSPEQVRRLTRYCSGVVAGSKIIELFQ
HGETEKIRALVESAKQQAAPNQL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaacaaaaattggaagcacagtttgaaacggttcttgcacgcggtgatcaagcg
tttgtcccttatattatggcaggggacggcggaatggaagagacggagaaaaggcttgcg
tttttagaagcttgcggggcaacggcaattgaacttggcattccgttttccgacccggtc
gcagacggcccggtcatccaggcggcaggactccgcgcttttaaggcaggtacgacaatg
aaaaaagtgctggaccatttaaaagcccatccaaggcaagttccgattattctcatgacg
tatttcaacccggtttttgcctacgggctggaaaaatttgcagcagactgcgcgaatgcc
ggtgttgacggactgattattccagatttgcccatcgaggaagaagaggaaattgccgga
gaactggcaaaatgcggcctggcgctcatccggctggctgccattacaagcccgaaagac
cggcttgaggaaatcgcctcccgttcagatgggtttctgtatgctgtcacggtcaccggt
acaaccggcacccgtacaaattttcacgacaatatcgaggattacctggatttcttatca
agcatcagccgggtgcctgttcttgccggctttggcgtttccagcccggagcaggtccgc
cgtttaacccgttactgcagcggcgtggtggccgggagcaaaatcatcgagctcttccag
cacggggaaacggaaaaaatccgcgcgcttgtggaaagcgcaaagcaacaagcagcacca
aaccagctgtaa

DBGET integrated database retrieval system