KEGG   Bacillus amyloliquefaciens subsp. plantarum NAU-B3: BAPNAU_3285Help
Entry
BAPNAU_3285       CDS       T02859                                 

Gene name
yvaK
Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bamb  Bacillus amyloliquefaciens subsp. plantarum NAU-B3
Brite
Enzymes [BR:bamb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BAPNAU_3285 (yvaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3453670..3454410)
Genome map
AA seq 246 aa AA seqDB search
MKIVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYKGHGVPPEEL
VHTGPEDWWKDVMDGYEYLRSEGYENIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPMHI
KSEEVMYEGVLSYARNYKKFEGKQPEQIEKEMKEFEKTPMNTLKSLQELIADVRKNVDMI
YSPTFVVQARHDHMINTESANIIYNEVETDDKQLKWYEESGHVITLDKERDLVHQDVYEF
LEKLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtgacaccaaaaccatttacatttaaaggcggagacaaagcggtgcttctg
ctgcacggatttacgggaaatacggcagacgtcagaatgctcggccgctacttgaatgag
cgcggctacacttgtcacgcgcctcaatataaagggcacggcgttccgccggaagagctg
gtacatacggggcctgaagattggtggaaagacgtcatggacggttatgaatatttacgg
tctgaaggctatgaaaacattgcggcctgcggactgtcgcttggcggggttttttcattg
aaattgggttacactgtacccataaagggaattgttcctatgtgtgcgccgatgcacatt
aaaagtgaagaggttatgtacgaaggagttctttcctacgcgcgcaattataaaaaattc
gaaggaaaacagccggagcagattgaaaaggaaatgaaggagtttgaaaaaacaccgatg
aatacgctcaaatcgcttcaagagctgattgccgatgtgcgcaaaaacgtcgacatgatc
tattccccgacatttgtggttcaggcacggcatgaccatatgatcaatacagaaagtgcg
aacatcatttacaacgaggtggaaacggacgacaaacagctgaaatggtatgaagaatca
ggccatgtcatcacgctcgataaagaacgggacctcgttcatcaggatgtgtacgaattt
ttagagaaactcgattggtaa

DBGET integrated database retrieval system