KEGG   Bacillus anthracis Ames: BA_1131Help
Entry
BA_1131           CDS       T00129                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ban  Bacillus anthracis Ames
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ban01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ban00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ban00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Structure
PDB: 

Jmol
Position
1104677..1106266
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLVGEMLPAYNEILTPEALSFLKELHENFNERRIELLQKRMKKQQKIDAGEF
PKFLEETKRIREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNS
PTWENAIEGQINLRDAVKGTISHKNENGKEYRLNSKTAVLIVRPRGWHLEEKHMQVDGKN
MSGSLVDFGLYFFHNAKALLEKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTI
KATVLLETIHASFEMDEILYELKDHSAGLNCGRWDYIFSFLKAFRNHNEFLLPDRAQVTM
TAPFMRAYSLKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREEIHVTEKDLLEVPVGTITEEGLRMNISV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELK
EEELAKIEREIGKEAFKKGRFQEATTLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcaaacttcacgggttacactcgtgggagaaatgttaccagcgtacaacgaa
atattgacacctgaggcgcttagttttttaaaggaactacatgaaaattttaatgagcgc
cgcatagaacttttacaaaagcgtatgaaaaaacaacagaaaattgatgcaggagagttt
ccgaagtttttagaagaaacaaagcgtatacgtgaagcggattggacaattgctaaattg
ccaaaagatttagaggatcgccgcgtagagattactggtccagtagatagaaagatggtt
attaacgctttaaattcgggagcacatctttttatggcggattttgaagattcgaattca
ccaacttgggaaaatgcaattgaaggtcaaataaacttacgagatgcagtaaagggaacg
atttcacataaaaatgaaaacggaaaagaatatcgtttaaatagtaaaacagctgtatta
attgtgcgtccaaggggatggcatttagaagaaaaacatatgcaagttgacggaaaaaat
atgtctggtagcttagtagatttcggactttattttttccataatgcgaaagctctttta
gaaaaaggaagcggtccatacttttacttaccgaaaatggaaagctatttagaagcaaga
ttatggaatgatgttttcgtatttgctcaaaaatatatcggtattccaaatggaacgatc
aaagcaacggtgttactggaaacgattcacgcttcgtttgaaatggatgaaattttgtat
gagcttaaagatcattctgctggattaaattgcggaagatgggattatatttttagtttt
ctaaaagctttccgtaatcataatgaatttttacttcctgatagagcgcaagtcacgatg
acggcgccgtttatgcgcgcgtattctttgaaagtcattcaaacttgtcaccgccgtaat
gcaccagctattggagggatggcagcacaaattccgattaaaaacaatcctgaagcgaat
gaagctgcttttgaaaaagtgcgtgctgataaggagcgagaagctttagacggtcatgac
gggacttgggttgcccacccgggacttgtgccagtcgcgatggaagtatttaatcacatt
atgaaaacaccgaatcaaatttttagaaaacgagaagaaatacatgttacagaaaaggat
ttattagaagtaccagtgggaacgattacagaagagggtcttcgtatgaatattagcgta
ggcattcaatatatcgcatcttggttaagcggacggggagcagcaccaatttataactta
atggaagatgcggcaacagctgaaatctcaagagcacaagtatggcaatggattcgccat
gaaggtggaaaattaaatgatggccgtaatattacacttgaattaatggaagagttaaaa
gaagaagagttagcaaaaatagaaagagagattggtaaagaagcctttaagaaagggaga
ttccaagaggcgacaacgttgtttacaaatctcgttcggaatgatgaattcgtaccattt
ttaacattaccaggttatgaaattttataa

DBGET integrated database retrieval system