KEGG   Bacillus anthracis Ames: BA_1131Help
Entry
BA_1131           CDS       T00129                                 

Gene name
aceB
Definition
(RefSeq) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ban  Bacillus anthracis Ames
Pathway
ban00620  Pyruvate metabolism
ban00630  Glyoxylate and dicarboxylate metabolism
ban01100  Metabolic pathways
ban01110  Biosynthesis of secondary metabolites
ban01120  Microbial metabolism in diverse environments
ban01200  Carbon metabolism
Module
ban_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ban00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BA_1131 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    BA_1131 (aceB)
Enzymes [BR:ban01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BA_1131 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 1084420
NCBI-ProteinID: NP_843616
Structure
PDB: 

Jmol
Position
1104677..1106266
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLVGEMLPAYNEILTPEALSFLKELHENFNERRIELLQKRMKKQQKIDAGEF
PKFLEETKRIREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNS
PTWENAIEGQINLRDAVKGTISHKNENGKEYRLNSKTAVLIVRPRGWHLEEKHMQVDGKN
MSGSLVDFGLYFFHNAKALLEKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTI
KATVLLETIHASFEMDEILYELKDHSAGLNCGRWDYIFSFLKAFRNHNEFLLPDRAQVTM
TAPFMRAYSLKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREEIHVTEKDLLEVPVGTITEEGLRMNISV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELK
EEELAKIEREIGKEAFKKGRFQEATTLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcaaacttcacgggttacactcgtgggagaaatgttaccagcgtacaacgaa
atattgacacctgaggcgcttagttttttaaaggaactacatgaaaattttaatgagcgc
cgcatagaacttttacaaaagcgtatgaaaaaacaacagaaaattgatgcaggagagttt
ccgaagtttttagaagaaacaaagcgtatacgtgaagcggattggacaattgctaaattg
ccaaaagatttagaggatcgccgcgtagagattactggtccagtagatagaaagatggtt
attaacgctttaaattcgggagcacatctttttatggcggattttgaagattcgaattca
ccaacttgggaaaatgcaattgaaggtcaaataaacttacgagatgcagtaaagggaacg
atttcacataaaaatgaaaacggaaaagaatatcgtttaaatagtaaaacagctgtatta
attgtgcgtccaaggggatggcatttagaagaaaaacatatgcaagttgacggaaaaaat
atgtctggtagcttagtagatttcggactttattttttccataatgcgaaagctctttta
gaaaaaggaagcggtccatacttttacttaccgaaaatggaaagctatttagaagcaaga
ttatggaatgatgttttcgtatttgctcaaaaatatatcggtattccaaatggaacgatc
aaagcaacggtgttactggaaacgattcacgcttcgtttgaaatggatgaaattttgtat
gagcttaaagatcattctgctggattaaattgcggaagatgggattatatttttagtttt
ctaaaagctttccgtaatcataatgaatttttacttcctgatagagcgcaagtcacgatg
acggcgccgtttatgcgcgcgtattctttgaaagtcattcaaacttgtcaccgccgtaat
gcaccagctattggagggatggcagcacaaattccgattaaaaacaatcctgaagcgaat
gaagctgcttttgaaaaagtgcgtgctgataaggagcgagaagctttagacggtcatgac
gggacttgggttgcccacccgggacttgtgccagtcgcgatggaagtatttaatcacatt
atgaaaacaccgaatcaaatttttagaaaacgagaagaaatacatgttacagaaaaggat
ttattagaagtaccagtgggaacgattacagaagagggtcttcgtatgaatattagcgta
ggcattcaatatatcgcatcttggttaagcggacggggagcagcaccaatttataactta
atggaagatgcggcaacagctgaaatctcaagagcacaagtatggcaatggattcgccat
gaaggtggaaaattaaatgatggccgtaatattacacttgaattaatggaagagttaaaa
gaagaagagttagcaaaaatagaaagagagattggtaaagaagcctttaagaaagggaga
ttccaagaggcgacaacgttgtttacaaatctcgttcggaatgatgaattcgtaccattt
ttaacattaccaggttatgaaattttataa

DBGET integrated database retrieval system