KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2325Help
Entry
BAMF_2325         CDS       T01321                                 

Gene name
alrB
Definition
alanine racemase (EC:5.1.1.1)
Orthology
K01775  
alanine racemase [EC:5.1.1.1]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
D-Alanine metabolism
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; D-Alanine metabolism [PATH:bao00473]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2384939..2386120
Genome map
AA seq 393 aa AA seqDB search
MKKLCREVWIEVDLDAIKKNIRAIRRHIPNKSKIMAVVKANAYGHGSVEVARQALESGAS
ELAVASVEEGIVLRRAGITAPILVLGFTALSCVKKSAVWNITLSAFQVSWIKKANQILEE
EAVSKRLSIHINVDTGMGRLGVRTEKDLLAVVKALKSSTYLSWDGIFTHFSTADEPDTEL
TMLQHEKFISFLRFLKDQGITLPTVHMCNTAAAIAFPEFSADMIRLGIGLYGLYPSAYIK
ELDLVKLTPALSLKARIAYVKAMVTEPRTVSYGATYIAEPGEIIATIPIGYADGYSRALS
NRGFILYRGRRVPVAGRVTMDMIMVSLGESEGKQGEEVVIYGKQKGAEISVDEIAEMLGT
INYEVVSTLSRRVPRFYIRDGEIIKVSAPVLYV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactttgccgggaagtttggattgaagttgaccttgatgcgataaaaaagaat
atacgggcgatccgccgccatattccgaataagtctaagattatggccgtcgtaaaagca
aacgcgtatggccacgggtctgtcgaagtagcgcggcaggcactggaaagcggagcgagc
gagctcgcagtcgccagcgttgaagaggggattgtgttacgaagagcggggattacggca
ccgatccttgtactcggctttaccgctctcagctgtgtgaaaaagtctgccgtctggaat
ataacattgtcagcgtttcaagtcagctggatcaaaaaagcgaatcagatattggaagaa
gaagcggtttcgaaacggctgtccattcatattaatgtggataccgggatgggccggctt
ggtgtacgcacagaaaaagacctgttagcagttgtaaaagcgctcaagtcgagtacatac
ctgtcatgggacgggatctttacccatttttcaacagcggatgaacctgatactgaattg
acgatgctgcagcacgaaaaatttatcagctttctccgttttttaaaagatcaaggcatt
acgctccctaccgtgcatatgtgcaacacagcagccgctatcgctttcccggaattcagc
gccgatatgatccgtttaggcatcggtttatatggattatacccgtccgcctatatcaag
gagctggatcttgtaaaactcacgcccgcactcagtttaaaggcgcgtatcgcttatgtg
aaagccatggtgacagagccccggaccgtcagttatggtgctacatatatcgccgaaccg
ggtgaaatcatcgcaacaattccgatcggctatgctgacggttactcgcgcgccctttcc
aaccgcgggtttattctttatcgcggcagacgggtgccggtggcggggagagtgacgatg
gatatgattatggtcagtttgggtgagagtgagggcaaacaaggagaagaagtcgtcatc
tacggtaaacaaaaaggagccgagatttcagttgatgagattgccgaaatgctaggtacg
attaattatgaagtcgtatctacgttaagccgtcgcgtcccccgcttttatatcagagac
ggcgagatcatcaaagtatcagctcccgtattatacgtgtag

DBGET integrated database retrieval system