KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2325Help
Entry
BAMF_2325         CDS       T01321                                 

Gene name
alrB
Definition
alanine racemase (EC:5.1.1.1)
Orthology
K01775  
alanine racemase [EC:5.1.1.1]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
D-Alanine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BAMF_2325 (alrB)
Enzymes [BR:bao01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BAMF_2325 (alrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2384939..2386120
Genome map
AA seq 393 aa AA seqDB search
MKKLCREVWIEVDLDAIKKNIRAIRRHIPNKSKIMAVVKANAYGHGSVEVARQALESGAS
ELAVASVEEGIVLRRAGITAPILVLGFTALSCVKKSAVWNITLSAFQVSWIKKANQILEE
EAVSKRLSIHINVDTGMGRLGVRTEKDLLAVVKALKSSTYLSWDGIFTHFSTADEPDTEL
TMLQHEKFISFLRFLKDQGITLPTVHMCNTAAAIAFPEFSADMIRLGIGLYGLYPSAYIK
ELDLVKLTPALSLKARIAYVKAMVTEPRTVSYGATYIAEPGEIIATIPIGYADGYSRALS
NRGFILYRGRRVPVAGRVTMDMIMVSLGESEGKQGEEVVIYGKQKGAEISVDEIAEMLGT
INYEVVSTLSRRVPRFYIRDGEIIKVSAPVLYV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactttgccgggaagtttggattgaagttgaccttgatgcgataaaaaagaat
atacgggcgatccgccgccatattccgaataagtctaagattatggccgtcgtaaaagca
aacgcgtatggccacgggtctgtcgaagtagcgcggcaggcactggaaagcggagcgagc
gagctcgcagtcgccagcgttgaagaggggattgtgttacgaagagcggggattacggca
ccgatccttgtactcggctttaccgctctcagctgtgtgaaaaagtctgccgtctggaat
ataacattgtcagcgtttcaagtcagctggatcaaaaaagcgaatcagatattggaagaa
gaagcggtttcgaaacggctgtccattcatattaatgtggataccgggatgggccggctt
ggtgtacgcacagaaaaagacctgttagcagttgtaaaagcgctcaagtcgagtacatac
ctgtcatgggacgggatctttacccatttttcaacagcggatgaacctgatactgaattg
acgatgctgcagcacgaaaaatttatcagctttctccgttttttaaaagatcaaggcatt
acgctccctaccgtgcatatgtgcaacacagcagccgctatcgctttcccggaattcagc
gccgatatgatccgtttaggcatcggtttatatggattatacccgtccgcctatatcaag
gagctggatcttgtaaaactcacgcccgcactcagtttaaaggcgcgtatcgcttatgtg
aaagccatggtgacagagccccggaccgtcagttatggtgctacatatatcgccgaaccg
ggtgaaatcatcgcaacaattccgatcggctatgctgacggttactcgcgcgccctttcc
aaccgcgggtttattctttatcgcggcagacgggtgccggtggcggggagagtgacgatg
gatatgattatggtcagtttgggtgagagtgagggcaaacaaggagaagaagtcgtcatc
tacggtaaacaaaaaggagccgagatttcagttgatgagattgccgaaatgctaggtacg
attaattatgaagtcgtatctacgttaagccgtcgcgtcccccgcttttatatcagagac
ggcgagatcatcaaagtatcagctcccgtattatacgtgtag

DBGET integrated database retrieval system