KEGG   Bacillus velezensis CAU B946: BACAU_3787Help
Entry
BACAU_3787        CDS       T01692                                 

Gene name
bdhA3
Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
baq  Bacillus velezensis CAU B946
Pathway
baq00072  Synthesis and degradation of ketone bodies
baq00650  Butanoate metabolism
baq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baq00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BACAU_3787 (bdhA3)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BACAU_3787 (bdhA3)
Enzymes [BR:baq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BACAU_3787 (bdhA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 Epimerase Methyltransf_25 3HCDH_N DUF4406 Methyltransf_23 Methyltransf_12 TrkA_N RmlD_sub_bind Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: CCF07321
Position
3984775..3985581
Genome map
AA seq 268 aa AA seqDB search
MFPGGVTMSKLLESKVALVTGAASGIGLEIAREFAKEGAKVVISDLNEKAVHHAAEELKG
QGYEVLPAVCDVTNEEQVEKSFSKTLETFGRMDILVNNAGIQHVSDIENFPTDKFEFMLK
LMLTAPFGATKRAFPLMKKQKFGRIINMASINGLIGFAGKAAYCSAKHGLIGLTKVSALE
GAEYGITVNALCPGYIDTPLVQNQLQDIAETRGISIEKVFEEVIYPLVPQKRLLAVQEIA
DYAVFLASDKAKGVTGQAVVMDGGYTAQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctggaggggttactatgagtaaattattagaaagtaaagttgctcttgttaca
ggcgcggctagcggaattggtttagaaattgcacgtgaattcgctaaagaaggcgcaaaa
gtggtaatttccgatttgaacgaaaaagccgtgcatcatgcagctgaggaacttaaggga
caaggatatgaagtcctgcctgcggtttgtgatgtaacaaacgaagaacaagttgaaaaa
agtttctctaagacacttgaaacctttgggcgaatggatattctggtaaacaatgcgggg
attcagcatgtgtccgatatagaaaacttcccgactgataaatttgaatttatgctgaaa
ttaatgcttactgctccttttggtgcgacaaaaagagcgttccctttgatgaaaaaacaa
aaatttggccgcatcatcaatatggcttccataaatggtttaattggttttgcagggaaa
gcagcttattgcagcgctaaacacggtttgatcggtttaactaaagtatcagcattagaa
ggagcggaatacggaattactgtcaatgccttgtgtccgggatatatcgacactccattg
gtacaaaaccagttacaagatattgcagagactagaggcatttctatagaaaaggtgttt
gaagaagtcatttaccccttggttcctcaaaaacgtttgttagccgtgcaagaaatcgct
gattacgcagtattcctcgccagtgacaaagctaaaggagttacagggcaggccgtcgta
atggatggcggctatacagcccaataa

DBGET integrated database retrieval system