KEGG   Bacillus anthracis Sterne: BAS2066Help
Entry
BAS2066           CDS       T00184                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bat  Bacillus anthracis Sterne
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BAS2066
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAS2066
  Lipid metabolism
   00071 Fatty acid degradation
    BAS2066
  Amino acid metabolism
   00350 Tyrosine metabolism
    BAS2066
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BAS2066
   00626 Naphthalene degradation
    BAS2066
Enzymes [BR:bat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BAS2066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2075701..2076903
Genome map
AA seq 400 aa AA seqDB search
MQEVAEFRMPKSVLYGRNSLEKLWEQSKKFGKRAFIVTDTIMEDLGYVERCIQQLNTKGI
TVITYNKVNAEPTNIHVLEALTICKEGKCDFIIGLGGGSCIDAAKAVAVLYTNGGEVEDY
VQKDREIDNDPLPLIAIPTTSGTGSEVTSVAVITNKRTDVKMMMKHPSFTPQVAIIDPIL
TRSVPPHITAATGIDALCHAVEAYISKVSQSLTDVLALSAIESIMKYLRIAYEDGENMEA
REAMMIASLQAGIAFSNASVTLVHGMSRPVGALFHVPHGISNAILLPTVLEYTKGSAVKR
LAEIGRCLNKDLYSYCDEEVADYTLGEIKKLCFDLHIPNLKEYGIGELEFEKAISKMASD
AIESGSPANNPRVPSYDEIKQLYRECFHYKYEDSIKTLGD
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagaagttgctgagtttcgtatgccgaagtctgtattatatggaagaaattctctt
gaaaagctgtgggaacaatctaagaaattcgggaaaagagcgtttatagttacggataca
attatggaggatttaggatatgttgagaggtgtatacaacaattaaatacgaaaggtata
actgttattacatataataaagtaaatgctgagcctacaaatatacacgtgttagaggcg
ttaactatttgtaaagaaggaaagtgtgattttataatcggtcttggtggtggaagttgt
attgatgcagcaaaagcagttgcggtgttatatacaaatggcggagaagtggaagattat
gtccaaaaggatagggaaatagacaatgatccgctaccacttattgcaatcccaacaacc
tctggaactggatcggaagtaacaagtgtagcagtaattacgaataaacgaacagatgta
aaaatgatgatgaagcatccgagttttaccccgcaagtagcaattattgacccaatttta
acacgttcggtaccacctcacattacagcagcaacagggatagatgctttatgtcatgca
gtcgaagcatatatttctaaagtttcacaatcacttacagatgtattagctctttccgct
attgaaagtattatgaaatatttacgtattgcatatgaagatggagagaatatggaggca
agagaagcgatgatgatagcgtccttacaagctggaattgcattttctaatgcatctgtt
acattagttcatggcatgtcgagaccagtaggagcattatttcatgtaccacatggtata
tcgaatgcaatactattacctacagttttagagtatacaaaaggtagtgcggtaaaaaga
ctagcggaaattggccgctgtttaaataaagatttgtattcctattgtgatgaagaagta
gccgactacacgctgggggaaataaaaaaactttgttttgatcttcatattccaaattta
aaagaatacggaattggtgagcttgagtttgaaaaagctatttctaaaatggcgtcagat
gcaattgaaagtggaagtccagcgaataacccacgtgtgccatcatatgatgaaattaaa
cagttgtatcgagaatgttttcattataaatatgaagattcaataaaaacattaggggat
taa

DBGET integrated database retrieval system