KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_11025Help
Entry
BAMTA208_11025    CDS       T01824                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:baz00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2158269..2159126)
Genome map
AA seq 285 aa AA seqDB search
MGRPASEGKKKTAMGKGLNGKRIAIGGSRKTEEITRLIEKQGGTAVVRSLQGTVYLAEEQ
IEPDVRTFAEQKADWVIFTTGIGTETLLSVSEKIGLKEEFLAAVHEANIGCRGYKTYAAL
KKLGVTPHASDEDGTTRGLIRSLERFELKDKKVMIQLHGEKAPVLTEFLEKNGAEVFPVL
PYQHIPPERETVDKMLGELLNGEVDAVCFTTAIQVRSLFDYAKEKGSAKELQQAFETHVL
AAAVGKVTAEAIRDEGVNRVLAPDIERMGAMIIELSRYYESLTLS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcccggcatctgaagggaagaaaaaaacagcgatgggaaaaggattgaacgga
aaacggattgcgatcggcggttcgcggaaaacagaagagatcacgagattaatagaaaag
cagggcggaacggcagttgtccgttccctccaaggaaccgtatacctggcggaggaacag
attgaacccgacgtaagaacatttgctgagcaaaaagccgactgggtgatattcaccacc
ggcatcggtacggaaacgttattgtcagtatcggaaaaaatcggtctgaaagaagaattt
ttagcggccgttcatgaagcgaatatcggctgcaggggctataaaacatatgcggcctta
aaaaagctcggcgtcacgccgcatgcttcagatgaagacggtacgacaagaggcctgatc
cgctccttggaacggtttgaattgaaagacaaaaaagtcatgatccagcttcacggggaa
aaagcgcccgtcttaacggaattccttgagaaaaacggagcggaggtattccctgttctg
ccttatcagcatattccgcctgaaagggagacggtcgataaaatgctgggagagctgtta
aacggcgaggtcgacgccgtatgttttacgactgccattcaagtgcgttctctctttgat
tatgcaaaagaaaaagggtctgcaaaagaattgcagcaagcattcgaaacacatgtactt
gccgccgcagtcggcaaagtgacggctgaagcgatccgggatgaaggggtgaatagagtc
cttgctccggacatcgagcggatgggagcgatgattatcgagttatcccgttactatgaa
tctctgaccttatcataa

DBGET integrated database retrieval system