KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0982Help
Entry
BLC1_0982         CDS       T01841                                 

Definition
glycoside hydrolase family 3 domain protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BLC1_0982
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BLC1_0982
Enzymes [BR:bbc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BLC1_0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1174217..1175677
Genome map
AA seq 486 aa AA seqDB search
MPPVGRRMPRFVKVSARFARSTLLSVASGAPPAAICARELYNDSSHRRNRGPMIQHNDKP
QPNRNRRMVRIVTTVIVTLAIVAIAIGAFAPVRHATDSDTTNGKAAPTSVPSRTSSPAPS
TTISMPQTASPSPTPKTDGTSDRAKRIVEAMSLDERAGQLVMAALQYGNDPATLQAMIQE
QHVGNVILMGNWVSGVENVARATQALQRLNASTGLPGLLIATDQEGGTVQHLSGPGFDAM
PSATAQGQMPLDRLRAAARDWALPLKRSGLAMNLAPSVDTVTIERAVNEPIGALYRDFGL
DAQRNGEHAAAFIEGMRAGGVGSAIKHYPGLGSVRGNTDFTANGIVDDTTTENGTEVNAF
TSAIRQGKPAMVMVSLATYKLIDPDNPAAFSPAIVTDMLRRGTPFDGVVISDSLSAGAVS
SIAPQDLGVRFIDAGGDICCMNAASYTQPILDGIRSRAAADKGFAAKVTASAERVVRLKI
ELGLVQ
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtgccgccggtggggcgccggatgccacgcttcgtcaaggtgtctgcgcgcttcgcgcgt
agcacgctcctcagcgtggcatccggcgccccaccggcggcaatctgtgcccgcgaactg
tacaatgacagcagccatcgcagaaaccgaggacccatgatccagcacaacgacaagcca
cagccgaaccggaacaggcgcatggtccggattgtcacgaccgtcatcgtgacattggca
atcgtcgccattgcgattggggcattcgcaccggttcgccatgctaccgattccgacacg
acgaatggcaaagccgccccgacatcggttcccagccgcacatcatcgccagcccccagc
acgaccatttccatgccgcagacagcgtcgccttcgcccacccccaagacggatggcacc
tcggatcgggccaaacgcattgtagaggcgatgagcctcgacgaacgcgccgggcaattg
gtgatggccgcattgcaatacggcaatgaccctgccaccttgcaagcgatgattcaggag
cagcatgtggggaacgtgatcctgatgggcaactgggtgagcggcgtcgagaacgtggcg
cgtgccacacaggcactgcagaggttgaacgcctccaccggattgccaggattgctcatc
gccaccgatcaggagggcggcacggtccagcatctttcgggaccgggattcgatgccatg
cccagcgccacggctcagggtcagatgccactcgaccggctgcgcgcagccgcgcgggat
tgggccctccccctcaaacggtccggtctcgccatgaatctggctccttcggtggacacg
gtgacgatcgaacgtgccgtcaatgaaccgatcggcgcgctctaccgtgatttcggactc
gatgcccagcgcaatggcgagcatgctgcagctttcatcgaaggcatgcgcgccggcggt
gtgggcagtgccatcaagcattacccgggattgggatcggtgaggggcaacaccgatttc
acggcaaacggcattgtcgacgacacgacaaccgagaacggcacggaggtgaatgcattc
acctctgcgatccggcagggcaaacccgccatggtgatggtgtcgctggccacctacaaa
ctcatcgaccccgacaatcctgcagccttctcccccgccatcgtcaccgacatgctgcgc
agaggtaccccgttcgacggcgtggtgatctcggattccctctcggccggtgccgtgagc
tcgattgctccacaggatctgggcgtgcggttcattgatgcgggaggggacatctgctgc
atgaacgccgcaagctatacgcagccaattctggacggcatacgcagccgcgctgccgcg
gacaagggttttgccgccaaggtcactgcgagtgccgaacgcgtggtgagactgaaaata
gagctcggcttggtgcagtga

DBGET integrated database retrieval system