KEGG   Bifidobacterium bifidum PRL2010: BBPR_1571Help
Entry
BBPR_1571         CDS       T01340                                 

Gene name
malQ2
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BBPR_1571 (malQ2)
Enzymes [BR:bbp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BBPR_1571 (malQ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1850736..1852904)
Genome map
AA seq 722 aa AA seqDB search
MTESTESAERLARPLIHLARLVGLATSYIGMSDDYHEIDDDVLKALLGALGVDAHDDDAI
DDSVVRILRERHGRLVAPTVLHVVGKEDRVLLNTGIMQIPSATITLENGDEYQGALEPGA
GDGSQAYEVDGKFVATASITIPADLPMGYHTLHVSVGDRTQDATLISAPERIPMLPAMEH
DQLWGWMAQLYSIRSAGSWGVGDFEDLKTLMVDSHSKTGADFMLVNPLHACEPVAPLTPS
PYLPISRRFINFTYIRPEAIEEYAGLGDELKSQIGELHAQAEPLNGDAQIIDRDSMWRVK
MHALWLIFKAGRSEERQKAFDDYKSTSAEGLEAYATWCLCYDKWGAPTGEADSWEKRLDK
NSDEVQGLRRQFPDTLDFYRWLEWIADEQLGAAQQAAKDAGMQIGLMADMAVGVHPSGSD
VWWNPERFAKGATVGAPPDYFNQQGQDWSQPPLNPIELENTGYLTYRHMVQGMFAHAGAV
RIDHILGLFRLWWIPSGHTPKDGAYVQYDSEIMLGILALEASRAHGVVVGEDLGVVPDHV
STSLSAHQVLGCAVEWFEQMDGKFRAPKDWREFSLASVNTHDLPPAAGYLAYEHVELRER
LGLIEGSVEDFEQNARAEHKAMMVMLIVNGYLDPDLLKDEKAHEQEIVEALYRGLRGSPC
KLLAASIVDGVGERRAQNQPGTNNEYPNWRIPLADGKGNVVPLEELFSNTRLLSLAKVMQ
GR
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgacagagagtacagaaagtgcggagcgtctcgcgcgtccgctgatccatctggcgcgt
ctggttggattggccacgagctacatcggcatgagcgacgactatcacgagatcgatgat
gatgtcctgaaggcgttgctgggtgcgttgggcgtggacgcccatgacgatgacgccatc
gatgattccgttgtccgtatccttcgcgagcgccacgggcgtctcgtcgccccgaccgtg
ttgcatgtcgtcggcaaggaagatcgtgtgctgctcaacaccggtatcatgcagattccc
tccgcaaccatcacactggaaaacggcgacgaataccagggtgcgctggagccgggagcc
ggagacggatcgcaggcgtacgaggtcgacggcaagttcgtggcgacggcatccatcacc
atacccgcggatctgccgatgggataccatacgctgcatgtcagcgtgggcgaccgcacg
caggacgccacgctgatcagcgcccccgagcgtattccgatgctgccggccatggaacat
gaccagctgtggggctggatggcccagctgtattccatccggtccgccggatcctggggc
gtgggcgatttcgaggacctcaagaccctcatggtcgattcgcacagcaagaccggcgcc
gatttcatgctggtcaacccgctgcacgcgtgcgagccggtagcgccgctcaccccgtcg
ccgtacctgccgatttcccgccgcttcatcaacttcacgtacattcgtcccgaggcgatc
gaggaatatgccggcctcggcgatgaactgaaatcgcagatcggcgagctgcacgcgcag
gccgaaccgctgaacggggacgcgcagattatcgaccgtgattcgatgtggcgcgtgaag
atgcacgccctgtggctgatttttaaggccgggcgcagcgaggagcgtcagaaggcgttc
gacgactacaagagcacgtccgccgaagggcttgaggcctacgccacgtggtgcctgtgc
tacgacaagtggggcgcgccgaccggcgaagccgacagctgggagaagcgcctcgacaag
aacagcgacgaggtgcaggggctgcgtcgacagttccccgacacattggacttctaccgc
tggttggaatggatcgccgacgagcagctgggagccgctcagcaggccgcgaaggacgcc
ggcatgcagatcggcctcatggccgacatggcggtcggcgtgcatccgtccggctccgac
gtgtggtggaacccggagcgtttcgccaagggcgccacggtcggcgcgccgccggattac
ttcaaccagcaggggcaggactggagccagccgccactcaacccgatcgagctggagaac
accggctacctcacgtatcgtcacatggtgcagggcatgttcgcccatgcaggcgcggtg
cgcatcgaccacatcctcggcctgttccgcctgtggtggatcccctccgggcacacgccc
aaggacggcgcctatgtgcagtacgattccgagatcatgctcggcatcctggcacttgag
gcgtcacgcgcccacggcgtggtcgtcggcgaggatctgggcgtcgtgccggaccacgtc
tcgacgtcgctgtccgcgcatcaggtgctgggttgcgccgtcgaatggttcgagcagatg
gacggcaagttccgcgccccgaaggattggcgcgagttctcgctcgcctcggtgaacacg
cacgacctgccgcccgcagccggatatctcgcgtacgagcacgtcgaactgcgcgagcgc
ctgggactgatcgaaggatcggtcgaggacttcgagcagaacgcgcgcgccgagcacaag
gccatgatggtcatgctgatcgtcaacggctatctcgaccccgacctgctgaaggacgag
aaagcccacgagcaggagatcgtcgaggcgctgtaccgcggcctgcgcggctccccgtgc
aagctgctcgcggcgtccatcgtggacggcgtgggagagcgccgcgcccagaaccagccc
ggcaccaacaacgaatatccgaactggcgcatcccgctggccgacggcaagggcaatgtc
gtgccgctggaggagctgttctccaacacgcgtctgctctcgctcgccaaggtcatgcag
gggcgctga

DBGET integrated database retrieval system