KEGG   Bacillus cereus B4264: BCB4264_A2383Help
Entry
BCB4264_A2383     CDS       T00805                                 

Gene name
hemY2
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bcb  Bacillus cereus B4264
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCB4264_A2383 (hemY2)
Enzymes [BR:bcb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BCB4264_A2383 (hemY2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2284841..2286232
Genome map
AA seq 463 aa AA seqDB search
MKTVVVIGGGITGLSTMFYLEKLKKDYNIALNLILIEKEEYLGGKIHSVEEKDFIMESGA
DSIVARNEYVMPLVKDLNLEDEMVYNETGISYIYSENMLHPIPSDTIFGIPMSARSLFSS
TLVSTKGKIVALKDFITKNKEFTKDTSLALFLESFLGKELVERQIAPVLSGVYSGKLNEL
TMASTLPYLLDYKNKYGSIIKGFEENKTQFQSAGNKKFVSFKGGLSTIINRLEEVLTETV
VKKGAITTAVSKQEDRYEISFANHETIQADYVVLAAPHDIAQTLLQSNELNEQFNTFKNS
SLISIYLGFDILDEQLPADGTGFIVTENSDLHCDACTWTSRKWKHTSGKQKLLVRMFYKS
TNPVYETIKDYNEEELVRVALYDIEKSLGIKGEPEVVEVTNWKDLMPKYHLEHNQAVQAL
QEKMTNLYPNVYLAGASYYGVGIGACIGNGKNIANEIMATLNK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagttgttgttatcggtggaggtataacgggactttctactatgttttattta
gaaaaattaaaaaaggattataatatcgctttaaatttaattcttattgagaaagaagag
tatttaggtggtaaaatccatagtgtggaagaaaaggatttcattatggagtcaggagcg
gattcaatcgttgctcgtaatgaatatgttatgccacttgtaaaagatttaaatttagaa
gatgaaatggtatataatgaaacgggtatttcttacatatattctgaaaacatgttacat
ccgattccttctgatactatatttgggataccgatgagcgcccggtcgttgtttagcagt
acgctagtctcaacgaaggggaaaatcgtagctttaaaagattttataacgaaaaataaa
gagtttacgaaagatacatcacttgctctatttttagaaagtttcttagggaaagagtta
gtggaaagacaaattgctcctgtgctttcaggtgtatattctggtaaattgaatgagctt
acaatggcatctacattaccatatttactggattataaaaataagtatggaagtattatt
aaaggttttgaagagaataaaacacaatttcaatcagcaggaaataaaaaattcgtatca
tttaaaggtggactatctacgataattaatcgcttagaagaagtgctgactgaaactgtc
gtaaaaaaaggtgctataacgacggctgtaagtaaacaagaagatcgatatgagatttct
tttgcaaatcatgaaacaatacaagctgattatgttgttttagcagctccacatgatata
gcacaaactttattacagtctaatgagttaaatgagcagtttaatacatttaaaaactca
tctcttattagtatttatttaggatttgacatactagatgaacaactaccagctgacggt
acggggtttattgtaacggaaaacagtgatttacattgtgatgcttgtacatggacaagt
cgaaagtggaaacatacatcgggtaaacaaaaattattagttagaatgttttataagagt
accaatcctgtatatgaaacaatcaaggattacaatgaagaagaattagtacgagtagct
ttatatgatattgaaaagagtctcggaattaaaggtgaaccagaagtagttgaagttaca
aattggaaagatttaatgccgaaatatcatttagaacataatcaagcggttcaagcattg
caagaaaaaatgacaaatctttatccaaatgtatatttagctggtgcctcatattacggt
gttggaattggtgcgtgtattggaaatggaaagaatattgccaatgaaataatggctaca
ttaaataaataa

DBGET integrated database retrieval system