KEGG   Bartonella clarridgeiae: BARCL_1377Help
Entry
BARCL_1377        CDS       T01394                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcd  Bartonella clarridgeiae
Pathway
bcd00020  Citrate cycle (TCA cycle)
bcd00310  Lysine degradation
bcd01100  Metabolic pathways
bcd01110  Biosynthesis of secondary metabolites
bcd01120  Microbial metabolism in diverse environments
bcd01130  Biosynthesis of antibiotics
bcd01200  Carbon metabolism
Module
bcd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BARCL_1377 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BARCL_1377 (sucB)
Enzymes [BR:bcd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BARCL_1377 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: CBI77049
UniProt: E6YJL1
Position
complement(1500163..1501374)
Genome map
AA seq 403 aa AA seqDB search
MATEIRVPTLGESVTEATIGKWFKKIGEAVAMDEPLVELETDKVTVEVPSPVAGKLSEII
AKEGDIVEVNALLGIVEAGADGISASSASSPSVTSTPTSAPVVASVLASSLGGAMSLAPS
AAKLMAENNIEKNDISGSGKRGQILKGDVLDVLTQKTKTLASVSSAASVNIVHEERVRMT
KLRQTIARRLKDAQNTAAMLTTFNEVDMSTVMDLRKRYKDLFEKKHGVKLGFMGFFTKAV
CHALKELPAVNAEIDGTDIVYKNYVNAGIAVGTNKGLVVPVVRNADQMSIAEIEKEIGRL
GRLARDGKLAVADMLGGTFTITNGGVYGSLMSTPILNAPQSGILGMHAIKERAIVVGGQI
VIRPMMYLALSYDHRIVDGQEAVTFLVRVKESLEDPERLVLDL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggctactgaaatccgtgttcctactttgggcgaatcagttactgaggcaacaattggc
aaatggtttaagaaaattggtgaagccgtggctatggatgagcctttggttgagttagaa
actgataaggtaacagttgaggttccttctcctgttgccggaaaattatctgaaatcatt
gcaaaagaaggcgacatagttgaagtgaatgctctcttagggatagttgaagcaggagct
gatggtatctctgcatcatctgcatcttcaccttctgttacatctacgcctacatctgct
cctgtggtagcgtctgtgctggcttcctctttagggggagcgatgtctcttgcaccttca
gcagcaaagttaatggccgaaaataatatagagaaaaacgatatttcaggttctggaaag
cgtggacagattctcaaaggagatgttcttgatgttttaacgcaaaagacaaaaacatta
gcttctgtttcttctgctgcatctgtgaatatagtgcacgaagagcgagttcgtatgaca
aaattacgccagacaattgcacgccgccttaaagatgcacaaaatacagcagcaatgtta
accacatttaatgaagttgacatgtctactgtaatggatttgcgtaaacgttacaaagat
ctttttgaaaagaagcatggtgttaagcttggctttatgggcttttttaccaaagctgtt
tgccatgcgttaaaagagcttcctgctgttaatgcggaaattgatggaacagatattgtt
tataaaaactatgttaatgctggaattgctgttggaacaaacaaaggacttgttgttccg
gttgttcgtaatgcagatcaaatgtcaattgcagaaattgaaaaagaaattggtcgttta
ggacgtcttgctcgtgatggaaaattggcggttgctgatatgttgggtggaacattcact
attactaatggcggtgtttatgggtcgttaatgtcgacgccgattttgaatgcaccgcaa
tctggtattttgggaatgcatgcgattaaagaacgtgcgatagtggttggaggacaaatt
gtgattcgtccaatgatgtatttagcgctttcttatgatcatcgtattgtagatgggcaa
gaagctgttactttccttgtgcgtgttaaagaaagtttggaagatccggaacgtcttgtt
cttgatttataa

DBGET integrated database retrieval system