KEGG   Bacillus cereus G9842: BCG9842_B0371Help
Entry
BCG9842_B0371     CDS       T00815                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bcg  Bacillus cereus G9842
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bcg00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4676187..4676990)
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHLGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVDGIILSSPCLGVVT
GPSAPLQFAAKILNVVAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEIAHKKIDAFPDVPLLLMQACEDKLVDKTRVRMWFDNVKISDKAYKEWPNCYHELLN
EYERDEILNYIQSFTEMHVNNIVKTNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagcagaggaagcgaaagctgtcattgttatcgtgcacggcgcaatg
gaatatcacggacgttacgaagccgttgcggaaatgtggaatcatctcggctaccacgtc
gtgatgggggaccttccgtcacatggaacgacttcaagaaatagaggacatattgattcg
tttgatgaatacatagaggaagttaaattatgggtgaaagaagcaagaaagtataggtta
cctatttttctattcggtcatagtatgggtggtcttattgtcattcgtatgatgcaagaa
acgaagagagaagatgtagatggtattattttgagttcgccttgtttaggggtagtgact
gggccctctgctccgcttcaatttgctgcaaaaatattaaatgttgtggctccaaaattg
caatttgcaacgaatcttacggtggaaatgtcaacaaggaatcatgaagtgagagatgca
atggagaatgattcattgttcttgcgcaaagtatcagtgcgttggtatagtgaattgatt
aagtctattgaaattgctcataagaaaatagatgcttttccagatgttccgctcttgcta
atgcaagcatgtgaggataaacttgtagataaaacacgtgtccgcatgtggtttgataat
gttaaaataagtgataaggcatataaagaatggccgaattgttatcatgagttattaaat
gagtatgagcgtgatgaaattttgaattatattcagtcatttactgaaatgcatgtcaat
aatatagtaaaaacaaacaaataa

DBGET integrated database retrieval system