KEGG   Burkholderia cenocepacia HI2424: Bcen2424_4871Help
Entry
Bcen2424_4871     CDS       T00415                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00430  Taurine and hypotaurine metabolism
bch00620  Pyruvate metabolism
bch00640  Propanoate metabolism
bch00680  Methane metabolism
bch01100  Metabolic pathways
bch01120  Microbial metabolism in diverse environments
bch01200  Carbon metabolism
Module
bch_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcen2424_4871
   00640 Propanoate metabolism
    Bcen2424_4871
  Energy metabolism
   00680 Methane metabolism
    Bcen2424_4871
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Bcen2424_4871
Enzymes [BR:bch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Bcen2424_4871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ABK11605
JGI: Bcen24244871
Position
2:complement(1873964..1875172)
Genome map
AA seq 402 aa AA seqDB search
MRHPVLVLNAGSSSLKFSVYDTHEDCSLDAGLHGQVENLHDTPHLFVTDAHGATLADSAV
ARPGHQGAIEALHAWFAAHVGREAALDGVGHRVVHGGPYFTAPVRIDARVLDAIAALAPL
APLHQPHHVDAIRAVAAVAPNLPQVACFDTAFHATVPALEREFALPRALTEQGIVRYGFH
GLSYEYIATALAALDPSWMQHRTVVAHLGNGASLCALANGRSVATTMGFTAVDGLPMGTR
TGALDPGVILYLQRHTGRSLDEVEHLIYAESGLLGVSGVSSDMRTLLASDAPSAAHAVEL
FAYRAARELAALAGVLGGLDTLVFTAGIGEHAPRVRERICRRAAWLGIVLDDAANAAGLP
VMSSDASRVTVRVIPTDENLMIARHTRRVLDDAIPSTPYPTR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctgtcctggtgctcaacgccggctcgtcgagcctcaagttttcggtctac
gacacgcacgaggattgttcgctcgatgcgggcctgcacgggcaggtcgagaacctgcat
gacaccccgcatctgttcgtgaccgatgcacatggcgcgacgctcgccgacagcgccgtc
gcgcgaccggggcatcaaggcgcgatcgaggcgctgcacgcgtggttcgccgctcacgtc
gggcgggaggccgcgttggacggcgtcgggcaccgggtcgtgcatggcggcccgtatttc
accgcgccggtgcggatcgacgcgcgcgtgctcgatgcaatcgcggcgcttgcgccgctc
gcaccgctgcaccagccgcatcacgtcgacgcgattcgcgcggtggccgcggttgcgccg
aacctgccgcaggtcgcgtgtttcgacaccgcgttccatgcgacggtgccggcgctcgaa
cgggagttcgcgttgccgcgcgcgctgaccgagcagggcatcgtgcgctacgggtttcac
gggctgtcgtacgagtacatcgcgacggcgctcgcggccctcgatccgtcgtggatgcag
caccggacggtggtcgcgcacctcggtaacggcgcaagcctgtgtgcgctcgcgaacggc
cgcagcgtcgcgacgacgatggggttcacggccgtcgacgggctgccgatgggcacacgc
accggcgcgctggaccccggcgtgatcctgtacctgcagcgtcacacgggccgctcgctc
gacgaggtcgagcatctgatctatgccgaatcgggcttgctgggcgtgtcgggcgtgtcg
agcgacatgcgcacgctgctcgcgagcgacgcaccgtcggccgcgcatgcggtcgagctg
ttcgcctatcgcgcggcccgcgaactcgccgcgctggccggcgtgctcggcggtctcgac
acgctcgtgttcacggcgggcatcggcgagcacgcgccgcgcgtgcgcgaacggatctgc
cgccgcgcggcgtggctcggcatcgtactcgacgacgcggcgaacgcggccggcctgccg
gtgatgtcgagcgacgcgtcgcgcgtgacggtgcgcgtgatcccgaccgacgagaacctg
atgatcgcgcgccacacgcgccgcgtgctggacgacgcgattccctccacgccgtatccg
acccggtga

DBGET integrated database retrieval system