KEGG   Burkholderia cenocepacia HI2424: Bcen2424_4871Help
Entry
Bcen2424_4871     CDS       T00415                                 

Definition
acetate kinase
Orthology
K00925  
acetate kinase [EC:2.7.2.1]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Class
Metabolism; Overview; Carbon metabolism [PATH:bch01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bch00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bch00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bch00680]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:bch00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1873964..1875172)
Genome map
AA seq 402 aa AA seqDB search
MRHPVLVLNAGSSSLKFSVYDTHEDCSLDAGLHGQVENLHDTPHLFVTDAHGATLADSAV
ARPGHQGAIEALHAWFAAHVGREAALDGVGHRVVHGGPYFTAPVRIDARVLDAIAALAPL
APLHQPHHVDAIRAVAAVAPNLPQVACFDTAFHATVPALEREFALPRALTEQGIVRYGFH
GLSYEYIATALAALDPSWMQHRTVVAHLGNGASLCALANGRSVATTMGFTAVDGLPMGTR
TGALDPGVILYLQRHTGRSLDEVEHLIYAESGLLGVSGVSSDMRTLLASDAPSAAHAVEL
FAYRAARELAALAGVLGGLDTLVFTAGIGEHAPRVRERICRRAAWLGIVLDDAANAAGLP
VMSSDASRVTVRVIPTDENLMIARHTRRVLDDAIPSTPYPTR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctgtcctggtgctcaacgccggctcgtcgagcctcaagttttcggtctac
gacacgcacgaggattgttcgctcgatgcgggcctgcacgggcaggtcgagaacctgcat
gacaccccgcatctgttcgtgaccgatgcacatggcgcgacgctcgccgacagcgccgtc
gcgcgaccggggcatcaaggcgcgatcgaggcgctgcacgcgtggttcgccgctcacgtc
gggcgggaggccgcgttggacggcgtcgggcaccgggtcgtgcatggcggcccgtatttc
accgcgccggtgcggatcgacgcgcgcgtgctcgatgcaatcgcggcgcttgcgccgctc
gcaccgctgcaccagccgcatcacgtcgacgcgattcgcgcggtggccgcggttgcgccg
aacctgccgcaggtcgcgtgtttcgacaccgcgttccatgcgacggtgccggcgctcgaa
cgggagttcgcgttgccgcgcgcgctgaccgagcagggcatcgtgcgctacgggtttcac
gggctgtcgtacgagtacatcgcgacggcgctcgcggccctcgatccgtcgtggatgcag
caccggacggtggtcgcgcacctcggtaacggcgcaagcctgtgtgcgctcgcgaacggc
cgcagcgtcgcgacgacgatggggttcacggccgtcgacgggctgccgatgggcacacgc
accggcgcgctggaccccggcgtgatcctgtacctgcagcgtcacacgggccgctcgctc
gacgaggtcgagcatctgatctatgccgaatcgggcttgctgggcgtgtcgggcgtgtcg
agcgacatgcgcacgctgctcgcgagcgacgcaccgtcggccgcgcatgcggtcgagctg
ttcgcctatcgcgcggcccgcgaactcgccgcgctggccggcgtgctcggcggtctcgac
acgctcgtgttcacggcgggcatcggcgagcacgcgccgcgcgtgcgcgaacggatctgc
cgccgcgcggcgtggctcggcatcgtactcgacgacgcggcgaacgcggccggcctgccg
gtgatgtcgagcgacgcgtcgcgcgtgacggtgcgcgtgatcccgaccgacgagaacctg
atgatcgcgcgccacacgcgccgcgtgctggacgacgcgattccctccacgccgtatccg
acccggtga

DBGET integrated database retrieval system