KEGG   Burkholderia cenocepacia J2315: BCAL1010Help
Entry
BCAL1010          CDS       T00771                                 

Gene name
nagZ2
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BCAL1010 (nagZ2)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BCAL1010 (nagZ2)
Enzymes [BR:bcj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BCAL1010 (nagZ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1:1096806..1097834
Genome map
AA seq 342 aa AA seqDB search
MKTTPGPVMLDVVGTTLSRDDARRLAHPNTGGVILFARHFQNRAQLTALTDSIRAVREDI
LIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDRDVLLATKVATAVGYILAAELRACGID
MSFTPVLDLDYGHSKVIGDRAFHRDPRVVTLLAKSLNHGLSLAGMANCGKHFPGHGFAEA
DSHVALPTDDRTLDAILEQDVAPYDWLGLSLAAVIPAHVIYTQVDKRPAGFSRVWLQDIL
RGKLGFTGAIFSDDLSMEAAREGGTLTQAADAALAAGCDMVLVCNQPDAAEVVLNGLKAR
ASAESVRRIKRMRARGKALKWDKLIAQPEYLQAQALLSSALA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgactcccggcccggtcatgctcgacgtcgtcggcacgaccctgtcgcgcgac
gatgcgcggcgcctcgcgcatccgaataccggcggcgtgatcctgttcgcgcggcacttc
cagaatcgtgcgcaactgaccgcgctgaccgattcgatccgcgcggtgcgcgaagacatc
ctgatcgccgtcgatcacgaaggcgggcgcgtgcagcggttccgcaccgacggcttcacg
gtgctgcccgcgatgcgtcgcctcggcgagctgtgggatcgcgacgtgctgctcgcgacg
aaggtcgcgaccgccgtcggttacatcctggccgccgagctgcgcgcgtgcgggatcgac
atgagcttcacgcccgtcctcgatctcgactacgggcactcgaaggtgatcggcgatcgt
gcgttccatcgcgatccgcgcgtcgtcacgctgctggcgaagagcctgaaccatgggctg
tcgcttgccggcatggcaaactgcggcaagcattttcccgggcacggcttcgcggaggcc
gattcgcacgtcgcgctgccgaccgacgaccgcacgctcgacgcgatcctcgagcaggac
gtcgcgccgtacgactggctcgggctatcgctggccgcggtgatcccggcgcacgtgatc
tacacgcaggtcgacaagcggccggcgggcttttcgcgcgtgtggctgcaggacatcctg
cgcggcaagctcggcttcacgggtgcgatcttcagcgacgacctgtcgatggaggctgcc
cgcgaaggcggcacgctcacgcaggccgccgacgccgcgctcgccgccggttgcgacatg
gtgctcgtctgcaatcagccggatgcagccgaagtcgtgctgaacggactgaaggcgcgg
gcctcggccgagtcggtgcggcgcatcaagcggatgcgtgcgcgcggcaaggcgctcaag
tgggacaagctgatcgcgcagcccgagtatctgcaggcacaggcgctgttgagcagcgcg
ctggcgtaa

DBGET integrated database retrieval system