KEGG   Bacillus clausii: ABC2719Help
Entry
ABC2719           CDS       T00228                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bcl  Bacillus clausii
Pathway
bcl00010  Glycolysis / Gluconeogenesis
bcl00030  Pentose phosphate pathway
bcl00051  Fructose and mannose metabolism
bcl00052  Galactose metabolism
bcl00680  Methane metabolism
bcl01100  Metabolic pathways
bcl01110  Biosynthesis of secondary metabolites
bcl01120  Microbial metabolism in diverse environments
bcl01130  Biosynthesis of antibiotics
bcl01200  Carbon metabolism
bcl01230  Biosynthesis of amino acids
bcl03018  RNA degradation
Module
bcl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcl_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABC2719 (pfk)
   00030 Pentose phosphate pathway
    ABC2719 (pfk)
   00051 Fructose and mannose metabolism
    ABC2719 (pfk)
   00052 Galactose metabolism
    ABC2719 (pfk)
  Energy metabolism
   00680 Methane metabolism
    ABC2719 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ABC2719 (pfk)
Enzymes [BR:bcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ABC2719 (pfk)
Protein phosphatases and associated proteins [BR:bcl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ABC2719 (pfk)
Messenger RNA biogenesis [BR:bcl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ABC2719 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase PGP_phosphatase DUF4347
Motif
Other DBs
NCBI-ProteinID: BAD65254
UniProt: Q5WEF6
Position
complement(2853597..2854556)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHGLEVYGISYGYQGLINGDIKKMELGSVGDI
IHRGGTMLYTARCEEFKTLEGQQKGIEQLKKFGIEGLVVIGGDGSYRGAQQLTKHGFPTI
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHDRTYVIEVMGRHAGDLALWA
GLADGAETIVIPEAEHNMEQILATIKRGQERGKKHSIIVVAEGVGSGIEFGDRISKEMNM
ETRVTVLGHIQRGGSPTGADRVLASRLGAKAVDLLLEGKAGMTVGIQKNELVYHPIDEIL
DRPHTIDQEMYKLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacggataggtgtattaacaagtggcggggattctcccggtatgaacgcggccatt
cgtgcggttgtccggaaagcgatttttcatggtttggaagtgtacggcatttcctatggg
taccaaggtttaattaatggcgacataaaaaaaatggagcttggctctgttggtgatatt
attcaccgtggcggaacaatgctttacacagctcgctgtgaagaatttaaaacgttggaa
ggccaacaaaagggcattgaacagctgaagaaatttggaattgaagggctagtcgttatt
ggcggagatggttcttaccgcggcgctcaacaattaacgaaacatggttttccaacaatc
ggcgttccagggacgattgacaacgatattccaggtactgattttacaattggttttgat
acagcattaaatacagtcattgacgcgattgacaaaattcgtgatacggccacttctcat
gatcgtacatacgtgattgaagtaatgggccgccatgcaggggatttggctttgtgggct
ggccttgccgatggtgcagagaccattgtcattcctgaggctgagcataatatggagcaa
atactcgcaacgattaaacgtggccaagaacgtggcaagaagcacagcattattgtcgtc
gctgaaggggtcggttcaggcatagagttcggcgaccggatcagcaaagaaatgaatatg
gaaacgagagtaaccgtgctcggccatattcaacgcggaggatcgcccacaggggcagac
cgtgttttggcgagcagacttggtgcaaaggcagtcgatctgttgttagaaggcaaggct
ggcatgacagtcgggattcaaaaaaatgaacttgtttatcacccaattgatgaaatttta
gaccgcccacacacgattgatcaagaaatgtacaagctatctcaggaattatccatttaa

DBGET integrated database retrieval system