KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2707Help
Entry
Bcenmc03_2707     CDS       T00669                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Bcenmc03_2707 (glpK)
Enzymes [BR:bcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Bcenmc03_2707 (glpK)
Exosome [BR:bcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcenmc03_2707 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3016682..3018184
Genome map
AA seq 500 aa AA seqDB search
MQDQYILALDQGTTSSRAMLFDRQGNIVSIAQKEFEQIYPQPGWVEHDPQEIWSTQAGVA
AEAVTRTGLNGTSIAAIGITNQRETTIVWDRETGQPVYNAIVWQDRRTADFCDSLKKQGL
EAKVRAKTGLPIDSYFSATKIRWILDNVPGARDKARQGKLAFGTVDSWLVWNFTKHELHV
TDVTNASRTMLFNIHTREWDSELLELLDIPRSMLPEVKASSEIYGHTKTTVFASKIPLAG
IAGDQHAALFGQMCTTSGMVKNTYGTGCFLMMNTGDKPIESKNNLVTTIAWQIGDDVQYA
LEGSIFIAGAVVQWLRDGVGLIKTAAEIEALAASVPHTDGVYLVPAFAGLGAPHWNARAR
GSVFGVTRGTSAAHLARAALDAIAYQSLDVLAAMEADSGISIGELRVDGGASANDLLMQF
QADLLGVDAVRPQITETTALGAAYLAGLAIGYWKNLDEVRDQWQLDRRFAPSMPKEQVEQ
RMAGWQRAVRAAKAWADDTQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaccagtacatcctcgcgcttgaccagggcaccacgagttcccgcgcgatgctg
ttcgatcgccagggcaacatcgtatcgatcgcccagaaggaattcgaacagatctacccg
caacccggctgggtcgagcacgacccgcaggaaatctggtcgacgcaagccggcgtcgcc
gcggaagccgtcacgcgcacgggcctgaacggcacgtcgatcgcggcgatcggcatcacg
aaccagcgcgaaacgaccatcgtctgggatcgcgagacgggccagcccgtctacaacgcg
atcgtctggcaggatcgccgcaccgccgacttctgcgactcgctgaagaagcagggcctc
gaagcgaaggtgcgcgcgaagaccggcctgccgatcgactcgtacttctccgcgacgaag
atccgctggattctggacaacgtgccgggcgcgcgcgacaaggcgcgccagggcaagctc
gcgttcggcaccgtcgacagctggctcgtgtggaacttcacgaagcacgaactgcacgtg
accgacgtgacgaacgcgtcgcgcacgatgctgttcaacatccatacgcgcgaatgggac
agcgagctgctcgaactgctcgacatcccgcgcagcatgctgccggaagtgaaggcatcg
tcggaaatctacggccacaccaagaccacggtgttcgcgtcgaagatcccgctcgcgggc
atcgccggcgaccagcacgcagcgctgttcggccagatgtgcacgacctcgggcatggtg
aagaacacctacggcaccggctgcttcctgatgatgaacaccggcgacaagccgatcgag
tcgaagaacaacctcgtcacgacgatcgcctggcagatcggcgacgacgtgcagtacgcg
ctcgaaggcagcatcttcatcgcgggcgcggtcgtgcagtggctgcgcgacggcgtcggc
ctcatcaagacggccgcggaaatcgaggcgctcgccgcgagcgtgccgcacaccgacggc
gtgtatctcgtgcccgcgttcgccggcctcggcgcaccgcactggaacgcacgggcgcgc
ggctcggtgttcggcgtcacgcgcggcacgagcgccgcgcatctcgcgcgcgcggcgctc
gatgcgatcgcgtatcagtcgctcgacgtgctggccgcgatggaagccgattcgggtatc
agcatcggcgagttgcgcgtcgatggcggcgccagcgcgaacgacctgctgatgcagttc
caggccgacctgctcggcgtcgacgcggtgcgtccgcagatcaccgagacgaccgcgctc
ggcgcggcctacctcgcgggtctcgcgatcggctactggaagaacctcgacgaagtgcgc
gaccagtggcagctcgatcgccgcttcgcaccgtcgatgccgaaggagcaggtcgagcag
cgcatggccggctggcagcgtgcggtgcgcgccgcgaaggcgtgggccgacgacacccag
taa

DBGET integrated database retrieval system