KEGG   Bacillus cellulosilyticus: Bcell_0172Help
Entry
Bcell_0172        CDS       T01389                                 

Definition
(GenBank) phosphoglucosamine mutase
  KO
K03431  phosphoglucosamine mutase [EC:5.4.2.10]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00520  Amino sugar and nucleotide sugar metabolism
bco01100  Metabolic pathways
bco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bcell_0172
Enzymes [BR:bco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.10  phosphoglucosamine mutase
     Bcell_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_IV PGM_PMM_II
Motif
Other DBs
NCBI-ProteinID: ADU28461
UniProt: E6TTC1
Position
189774..191135
Genome map
AA seq 453 aa AA seqDB search
MGKFFGTDGVRGVANKELTPELAFKLGRYGGYVLTKERNKPKILIGRDTRISGHMLEGAL
VAGLLSIGAEVMRLGVISTPGVAFLTKALSADAGVMISASHNPVEDNGIKFFGSDGFKLL
DSQEEEIEKLLQTEDNLEDDLPRPVGGDIGQVNDYFEGGQKYLQFLKQTVQEDFSGLKIA
LDCAHGSASPLATHLFADLEAEQICTIGSSPNGVNINDQVGSTHPEALVSLVLEKGADIG
LAFDGDADRLIAVDEKGNVIDGDQIMYICAKYYKEQGRLSHNTVVTTVMSNIGFYKALEN
IGVQTKQTAVGDRYVMEEMRKGGYNIGGEQSGHIIFLDYATTGDGLLSAIQLCSILKASG
KPLSELASEMPKYPQKLVNVRVADKHALTTNEVIAAEIDIVEAEMNGEGRILVRPSGTEP
LVRVMAEAPTEELCDKYVDKIVAVVQRELGTAE
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagtttttcggaacagatggtgtgagaggagtagctaacaaagaattgacacct
gagctcgcatttaaactaggtcgttatggaggatatgttttaacaaaagaacgtaataaa
ccgaaaatattgattggaagagatacaagaatttccggtcatatgttagaaggtgcctta
gttgctggcctactctccattggtgcagaagtaatgcgattaggagtaatttcaacacca
ggagtagcatttttaacaaaggctttaagtgcagatgctggtgtaatgatttctgcctca
cataatcctgtagaagataacggtattaaattttttggttctgatggatttaagctcctt
gatagtcaagaggaagaaatcgaaaagctactacagacagaagacaatttggaagatgat
ttaccaagaccagttggtggagatattggccaagtaaacgattattttgaaggtggccaa
aagtatttacagtttttaaagcaaacagtacaagaggatttttctggattaaaaattgcg
ctagattgcgcccatggttctgcatcgccattagcaacacacttatttgcagatttagaa
gcggagcaaatttgtacgattggctcttcaccaaatggcgttaatattaatgatcaagta
ggatctacacaccctgaagcgctcgtttctcttgttttagaaaaaggagcggacataggt
ctcgcatttgacggcgatgctgacagattaattgcagtcgatgaaaaaggaaatgtcatt
gatggcgatcaaattatgtatatttgcgcaaaatactataaagaacaagggcgtttgagc
cataatacagttgtcacaacggtgatgagtaatattggtttttataaagcgctagaaaat
attggcgtccaaacgaagcaaacagctgttggcgatcgttatgttatggaagaaatgcgt
aaaggtggatataacattggtggtgaacaatctggccatattattttcttagattatgca
acgaccggagacggactcctttcagctatacagttatgtagtatattaaaggcttctggt
aaaccattgtctgaattagccagtgaaatgccgaaatacccgcaaaagcttgtaaatgta
cgcgtagcagataagcatgcattaacaacaaatgaagtaatagcggctgaaattgatatc
gtagaagcagaaatgaatggggaaggtcgtattttagtgcgcccttctggaacggaacca
ttagtaagagtgatggcagaagccccaacggaagagttatgcgataaatacgtagataaa
attgttgctgttgttcaaagagagttagggacagcggaataa

DBGET integrated database retrieval system