KEGG   Bacillus cytotoxicus NVH 391-98: Bcer98_0273Help
Entry
Bcer98_0273       CDS       T00560                                 

Definition
phosphoribosylformylglycinamidine synthase II (EC:6.3.5.3)
Orthology
K01952  
phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
bcy  Bacillus cytotoxicus NVH 391-98
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bcy00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
312963..315182
Genome map
AA seq 739 aa AA seqDB search
MSLMLEPNPTQIKEERIYAEMGLTDEEFAMIEKILGRLPNYTETGLFSVMWSEHCSYKNS
KPVLRKFPTTGERVLQGPGEGAGIVDIGDNQAVVFKMESHNHPSAIEPYQGAATGVGGII
RDIFSMGARPVALLNSLRFGELQSPRVKYLFEEVVAGIAGYGNCIGIPTVGGEVQFDPCY
EGNPLVNAMCVGLIHHEDIKKGQAHGAGNTVMYVGASTGRDGIHGATFASEELSESSEAK
RPAVQVGDPFMEKLLIEACLELIQSDALVGIQDMGAAGLTSSSAEMASKAGMGIEMYLDD
VPQRETGMTPYEMMLSESQERMLIVVKKGREQEVVELFEKYGLAAVAMGKVTEDKMLRLF
HKGEMVAEVPADALAEEAPIYHKPSKEAAYFREFQEMKMKTPKVDNYKETLLALLQQPTI
ASKEWVYDQYDYQVRTSTVVTPGSDAAVVRVRGTEKALAITTDCNSRYIYLDPETGGKIA
VAEAARNIVCSGGEPLAITDCLNFGNPEKPEIFWQIEKSVDGMSEACRTLQTPVIGGNVS
MYNERSGEAVYPTPTVGMVGLVHDLKHVTTQEFKQAGDLIYVMGETKAEFGGSELQKMMY
GKIFGQSPSIDLEVEAKRQKQLLEAIQAGLVQSAHDVAEGGLAVAIAESAIGAKGLGATV
KLAGEATAALFAESQSRFVVTVKREQQEAFEKVVEAIQVGEVTNTNEVTIHNEENEVLLT
ANVDEMRKAWKGAIPCLLK
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttaatgcttgaaccaaatccaacacaaattaaagaagaacgtatatatgcggaa
atggggttaacagacgaagagtttgccatgattgaaaagattttaggacgtctgccgaac
tatacggaaacagggcttttctctgttatgtggtcagagcattgtagttataaaaactca
aaaccagttcttcgcaagttcccaacaacaggagaacgtgtattacaaggacctggagaa
ggcgcaggtattgtagatattggtgataatcaagcagttgtatttaaaatggaaagtcac
aatcatccttcggcaattgagccgtatcaaggtgcagcaacaggggttggcggtattatt
cgtgatatattctctatgggagcacgtccggttgcattattgaactcactgcgcttcggt
gaactccaatcaccacgcgtgaagtatttatttgaagaagtagttgcagggattgcagga
tacggtaactgtattggtattccaactgttggcggagaagtacaatttgatccatgttat
gaaggaaacccacttgtcaatgcaatgtgcgttgggttaattcatcatgaagatataaaa
aaagggcaagcgcacggtgctggtaacacggttatgtatgtcggtgcttcaacaggacga
gacggtattcatggtgcaactttcgcatcagaagaactatctgagagttcagaagcaaaa
cgcccagcagtacaagtaggcgatccgtttatggagaaacttcttattgaagcatgctta
gagttaatccaatctgatgcgcttgttggaattcaagatatgggcgctgcgggcttaaca
tcatcttctgcggaaatggcaagtaaagcgggaatgggtattgaaatgtatttagacgat
gtgccacagcgtgaaacaggtatgacaccatatgaaatgatgttatctgaatcacaggaa
cgtatgttgattgtggtgaaaaaaggtagagagcaagaagttgtagagttatttgaaaag
tatggcttagcggcagttgcgatgggaaaagtaacggaagataaaatgcttcgtttattc
cataaaggtgaaatggtagcagaagtacctgcggatgcattagcagaagaagcgccaatt
tatcataaaccttcaaaagaggcagcatattttagggaatttcaagaaatgaaaatgaag
acgccaaaagtagataactataaagaaacattactagctttattacaacaaccaacgatt
gcaagtaaagaatgggtatatgatcagtatgattatcaagtacgcacaagtactgttgtt
acaccaggatcagatgcagcggtggtgcgagtacgtggtacagagaaggcattagcaatc
acaacggactgtaactctcgttatatttacttagatcctgaaacgggcggtaaaattgca
gtagcagaagctgcgcgtaatattgtatgttctggcggagaaccacttgcaatcacagat
tgcttaaattttggtaatccagagaaaccagaaattttctggcaaattgagaaatcagta
gatggtatgagcgaagcttgtcgtacattacaaactccagttattggtggaaatgtatca
atgtacaacgagcgcagcggtgaagctgtatatccaacaccaactgttggaatggttggg
cttgttcacgatttaaaacatgtaacaacacaagaatttaagcaagctggggatcttatt
tatgttatgggtgaaacgaaagctgaatttggtggaagtgaattacagaagatgatgtac
ggtaaaatcttcggtcaatcaccaagtattgatttagaagtagaagcaaaacgtcaaaaa
caattactagaagcaattcaggcgggacttgttcaatcggcacatgacgttgcagaaggc
ggattagcagttgcgattgctgaaagtgcaatcggtgcgaaaggattaggtgctactgtg
aaattagctggggaggcaacagcggcattattcgcagaatcacaatctcgttttgttgta
acagtaaaacgtgaacaacaagaagcgtttgaaaaagtagtagaagcaattcaagttggt
gaagtcacaaatacaaatgaagtaacaattcataatgaagaaaatgaagtactacttaca
gcaaatgttgatgaaatgagaaaggcttggaaaggggcaatcccatgcttgctgaaataa

DBGET integrated database retrieval system