KEGG   Brachypodium distachyon: 100828068Help
Entry
100828068         CDS       T01717                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 6
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00010  Glycolysis / Gluconeogenesis
bdi00030  Pentose phosphate pathway
bdi00051  Fructose and mannose metabolism
bdi00052  Galactose metabolism
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
bdi01200  Carbon metabolism
bdi01230  Biosynthesis of amino acids
bdi03018  RNA degradation
Module
bdi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100828068
   00030 Pentose phosphate pathway
    100828068
   00051 Fructose and mannose metabolism
    100828068
   00052 Galactose metabolism
    100828068
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100828068
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100828068
Protein phosphatases and associated proteins [BR:bdi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100828068
Messenger RNA biogenesis [BR:bdi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100828068
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 100828068
NCBI-ProteinID: XP_003564709
UniProt: I1HCW2
Position
2
AA seq 542 aa AA seqDB search
MESVVVAPAAAAQGAVAVAEQQQQKKKLLDQKMELPLVAALKAPAPASPCKWAMKKKLVG
GDAGYVLEDVPHLTDYMPELPTYPNPLQDNPAYSVVKQYFVNTDDTVTQKIVVHKTSARG
THFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLCDMYGVTSVVGIEGGY
KGFYSRNTVPLTPKSVNDIHKRGGTILGTSRGGHDTAKIVDSLQDRGINQVYIIGGDGTQ
QGASVIYEEVRRRGLKCSVVGVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESA
ENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLEFIEKRLKDSGHM
VIVVAEGAGQDLIAQSMNFVDTQDASGNKLLLDVGLWLSQKIKDHFKKKTNFPITLKYID
PTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEKQNKV
VITDRMWARVLCSTNQPCFLSHEDVENMKHDDDEQHHLHNTQLLDGSPAKCSPKCNGFAA
PL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgtcgtcgtcgctcctgccgctgctgctcaaggggcggtggcggtggcggag
cagcagcagcagaagaagaagcttctggaccagaagatggagctgccccttgtcgccgcc
ctgaaggcgcccgcgccggcgtcgccgtgcaagtgggcgatgaagaagaagctggtgggc
ggcgacgcggggtacgtgctcgaggacgtgccccacctcacggactacatgcccgagctc
ccgacgtacccgaatcctctgcaagacaaccctgcgtactcggtcgtcaagcagtacttc
gtcaacacagacgataccgtcacgcaaaagattgttgtacataagaccagtgcgaggggc
acacacttccggcgtgccggaccacggcaaagggtgtacttccagtccgatgaggtgaac
gcggccatcgtcacctgtggcggcctctgccccggcctcaacacagtgatccgcgagctc
gtatgcgggttatgcgatatgtacggtgtcaccagtgttgtgggcatagagggtggatac
aagggtttctattctcgaaacacggttccattgacaccaaaatccgtgaatgacatccac
aagagagggggtaccattcttggaacttcaaggggaggacacgacactgccaaaattgtt
gatagtcttcaggaccgtggtattaaccaggtttacattattggaggtgatggtacccag
caaggcgcttccgtaatttatgaggaagtccgtagacggggcctcaaatgttcagtagtt
ggtgtcccaaagaccatagacaatgatatcgcggtgattgacaagtcttttgggtttgac
actgccgtggaggaggctcaaagagccatcaacgctgcacatgttgaagctgagagtgca
gagaatggcattggtgttgtgaagctaatgggtcgcaacagtgggttcatcgccatgtat
gctactctggctagtcgagatgtggattgttgcttaatcccagagtcaccattctacctt
gaaggaaaaggagggctccttgagttcatcgagaaacggctcaaagacagtggccatatg
gtcattgtggtggccgagggtgctgggcaagatctcatcgcccaaagcatgaactttgtg
gacactcaggatgcttctggaaataagctgcttctggatgttggcctttggctttctcag
aagatcaaggatcatttcaaaaagaagaccaacttccctataactctcaagtacattgat
ccaacatacatgatccgtgcagtcagatcaaacgcctctgacaacgtttactgcactctg
cttgcgcacagcgccctccatggcgccatggcagggtacaccggtttcaccgtagctcca
gtcaatggcaggcatgcctacatcccattctatagaatcactgagaaacagaacaaagtc
gtgatcaccgataggatgtgggctagggtactgtgctcgacaaaccagccctgcttcctg
agccacgaggatgtcgagaacatgaagcacgacgatgacgagcaacaccacctgcacaac
acgcagctgctcgatggctcaccggcgaagtgctcaccaaagtgtaatgggtttgctgca
ccactgtga

DBGET integrated database retrieval system