KEGG   Brachypodium distachyon: 100828068Help
Entry
100828068         CDS       T01717                                 

Definition
6-phosphofructokinase 3-like
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bdi  Brachypodium distachyon
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100828068
   01230 Biosynthesis of amino acids
    100828068
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100828068
   00030 Pentose phosphate pathway
    100828068
   00051 Fructose and mannose metabolism
    100828068
   00052 Galactose metabolism
    100828068
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100828068
Protein phosphatases and associated proteins [BR:bdi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100828068
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 542 aa AA seqDB search
MESVVVAPAAAAQGAVAVAEQQQQKKKLLDQKMELPLVAALKAPAPASPCKWAMKKKLVG
GDAGYVLEDVPHLTDYMPELPTYPNPLQDNPAYSVVKQYFVNTDDTVTQKIVVHKTSARG
THFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLCDMYGVTSVVGIEGGY
KGFYSRNTVPLTPKSVNDIHKRGGTILGTSRGGHDTAKIVDSLQDRGINQVYIIGGDGTQ
QGASVIYEEVRRRGLKCSVVGVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESA
ENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLEFIEKRLKDSGHM
VIVVAEGAGQDLIAQSMNFVDTQDASGNKLLLDVGLWLSQKIKDHFKKKTNFPITLKYID
PTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEKQNKV
VITDRMWARVLCSTNQPCFLSHEDVENMKHDDDEQHHLHNTQLLDGSPAKCSPKCNGFAA
PL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgtcgtcgtcgctcctgccgctgctgctcaaggggcggtggcggtggcggag
cagcagcagcagaagaagaagcttctggaccagaagatggagctgccccttgtcgccgcc
ctgaaggcgcccgcgccggcgtcgccgtgcaagtgggcgatgaagaagaagctggtgggc
ggcgacgcggggtacgtgctcgaggacgtgccccacctcacggactacatgcccgagctc
ccgacgtacccgaatcctctgcaagacaaccctgcgtactcggtcgtcaagcagtacttc
gtcaacacagacgataccgtcacgcaaaagattgttgtacataagaccagtgcgaggggc
acacacttccggcgtgccggaccacggcaaagggtgtacttccagtccgatgaggtgaac
gcggccatcgtcacctgtggcggcctctgccccggcctcaacacagtgatccgcgagctc
gtatgcgggttatgcgatatgtacggtgtcaccagtgttgtgggcatagagggtggatac
aagggtttctattctcgaaacacggttccattgacaccaaaatccgtgaatgacatccac
aagagagggggtaccattcttggaacttcaaggggaggacacgacactgccaaaattgtt
gatagtcttcaggaccgtggtattaaccaggtttacattattggaggtgatggtacccag
caaggcgcttccgtaatttatgaggaagtccgtagacggggcctcaaatgttcagtagtt
ggtgtcccaaagaccatagacaatgatatcgcggtgattgacaagtcttttgggtttgac
actgccgtggaggaggctcaaagagccatcaacgctgcacatgttgaagctgagagtgca
gagaatggcattggtgttgtgaagctaatgggtcgcaacagtgggttcatcgccatgtat
gctactctggctagtcgagatgtggattgttgcttaatcccagagtcaccattctacctt
gaaggaaaaggagggctccttgagttcatcgagaaacggctcaaagacagtggccatatg
gtcattgtggtggccgagggtgctgggcaagatctcatcgcccaaagcatgaactttgtg
gacactcaggatgcttctggaaataagctgcttctggatgttggcctttggctttctcag
aagatcaaggatcatttcaaaaagaagaccaacttccctataactctcaagtacattgat
ccaacatacatgatccgtgcagtcagatcaaacgcctctgacaacgtttactgcactctg
cttgcgcacagcgccctccatggcgccatggcagggtacaccggtttcaccgtagctcca
gtcaatggcaggcatgcctacatcccattctatagaatcactgagaaacagaacaaagtc
gtgatcaccgataggatgtgggctagggtactgtgctcgacaaaccagccctgcttcctg
agccacgaggatgtcgagaacatgaagcacgacgatgacgagcaacaccacctgcacaac
acgcagctgctcgatggctcaccggcgaagtgctcaccaaagtgtaatgggtttgctgca
ccactgtga

DBGET integrated database retrieval system