KEGG   Brachypodium distachyon: 100830469Help
Entry
100830469         CDS       T01717                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase-like
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bdi  Brachypodium distachyon
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100830469
   00052 Galactose metabolism
    100830469
   00500 Starch and sucrose metabolism
    100830469
   00520 Amino sugar and nucleotide sugar metabolism
    100830469
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100830469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 475 aa AA seqDB search
MAATAVAAAADTKIEKLREAVAKLDEISENEKAGFISLVSRYLSGDADQIEWSKIQTPTD
EVVVPYDTLAPAPEDLDATKALLDKLVVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLI
VIQIESLNKKYGCNVPLLLMNSFNTHDDTQKIVEKYSNSNIDIHIFNQSQYPRIVTEDFL
PLPSKGQTGKDGWYPPGHGDVFPALNNSGKLDTLLAQGKEYVFVANADNLGAVVDIKILN
HLIHNQNEYCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVNEFKSIEKFKIFNT
NNLWVNLKAVKRLVEADKLKMEIIPNPKEVDGVKVLQLETAAGAAIRFFEKAIGANVPRS
RFLPVKATSDLLLVQSDLYTLVDGYVIRNPARVKPSNPSIELGPEFKKVANFLARFKSIP
SIVELDSLKVSGDVLFGSGVILKGKVTITAKPGVKLEIPDGAVLENKDINGPEDL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaccgccgttgctgccgccgccgacacgaagatcgagaagcttcgcgaggcc
gtcgccaagctcgacgaaattagcgaaaacgagaaggccgggttcatcagcctcgtgtcg
cgctacctcagtggcgatgcggatcagatcgagtggagcaagatccagaccccgaccgat
gaggtggtggtgccgtacgacaccctagctccggctcccgaagatctcgacgctacgaag
gctctgctcgacaagctcgtggtgctcaagctcaacggtgggctcgggacgaccatgggc
tgcactggtcccaagtctgtcattgaagttcgcaacgggtttacatttcttgaccttatt
gtgattcaaattgagtccctgaacaagaagtatggatgcaatgtccctttgcttctgatg
aactctttcaacactcatgatgatacacaaaagattgttgagaagtactccaactccaac
attgacattcacatttttaatcagagccaatatccccgcattgttactgaagacttcttg
ccacttccaagcaaagggcagacagggaaggatggctggtatcccccaggccatggtgat
gtgttccctgctttgaacaatagtggaaaacttgataccttattggcacagggaaaggag
tatgtcttcgtcgcgaacgcagataacttgggtgcagtagttgacatcaagatactaaac
cacctgatccataaccagaacgagtactgcatggaggttaccccaaaaacattggctgat
gttaaaggtggtaccctcatatcatatgaaggaagggtccagctcttggagattgcccaa
gtccctgatgagcatgtgaatgaattcaagtcaatcgagaagttcaagatattcaatacc
aacaacttgtgggtgaacttgaaggcagtcaagaggcttgtagaagctgacaaactcaag
atggaaatcattcccaaccctaaggaagttgatggtgtgaaagtcctacaactcgaaact
gcagctggggccgcgatacggttcttcgagaaagcaatcggtgctaacgttccccgctca
aggtttctgcctgtgaaggctacatctgatttgttgcttgtgcagtctgatctttatacc
ttggttgatggctacgtcatccgcaaccctgctagagtcaagccatcaaacccttcaatt
gagcttggtcctgagttcaaaaaggttgctaacttccttgcccgattcaaatcgatccca
agcattgttgagcttgacagcttgaaggtctctggtgatgtcttgtttggctctggcgta
atcctcaagggcaaggtgaccatcactgcgaagcctggagtcaagctggagattccagac
ggagctgtgcttgagaacaaggacatcaacggcccagaggatctttga

DBGET integrated database retrieval system