KEGG   Bdellovibrio exovorus: A11Q_2549Help
Entry
A11Q_2549         CDS       T02492                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bex  Bdellovibrio exovorus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bex01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bex01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2579858..2580706
Genome map
AA seq 282 aa AA seqDB search
MSEQNHQPRTPPLAPHFLKIFLPINLLAPFALYLFIANFSWMNLLILIIGWLCIGGYGIA
VGYHRLLSHKAFLTPKWVERVLTFFGLFAGQGSSLFWVAVHRGLHHPYADTEKDLHSPIH
GNFMAYVGWQMYLNPSKVTFKQCRDLLQDPYQVFLHKHYNKIFWTVIVLATLIDWRLGLF
GFVLPSFISMHTENCVDLFCHKRNLGYRNYDINDNSTNIWWLGYFGFGQGWHNNHHNRPY
THYYSEKWWELDLTRLMIWPIKLRKKSGAPAKPAPAVQTQTT
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaaaaccatcagccacgaacacccccactagctcctcactttctaaaaatc
tttctgccaattaatttgctagcaccatttgctctttatctttttattgcgaatttcagt
tggatgaaccttttgatcttgatcatcgggtggctctgcatcggtggatatggtattgcc
gttggttaccatcggcttttatcacacaaagcttttttaactccgaagtgggttgaaaga
gtgctgactttctttggtctttttgcaggacagggctctagtttattttgggttgctgtc
catcgcggattacatcacccctatgccgataccgaaaaagatctgcacagtcctattcat
ggaaacttcatggcctatgtcggttggcagatgtacttaaatccatctaaggtcacattc
aaacagtgccgtgatcttttacaagatccctatcaggtcttcttacacaagcactacaac
aagattttctggactgtgattgttctggcaactcttatcgactggcgcttaggcctcttc
ggctttgtactgccttcttttatttcgatgcacacggaaaactgtgtggatcttttctgt
cataaaagaaatctgggctatcgcaattatgatatcaacgacaactccactaatatttgg
tggctcggctacttcggctttggacaaggctggcacaacaaccatcacaataggccttac
acgcactactactcagaaaaatggtgggagctagatttaactcgtctgatgatttggcca
atcaaactgcgcaaaaaatcgggcgctccagcaaagcccgcacccgccgtgcagacacag
acaacttag

DBGET integrated database retrieval system