KEGG   Bdellovibrio exovorus: A11Q_2549Help
Entry
A11Q_2549         CDS       T02492                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bex  Bdellovibrio exovorus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bex00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    A11Q_2549
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    A11Q_2549
Enzymes [BR:bex01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     A11Q_2549
Lipid biosynthesis proteins [BR:bex01004]
 Desaturase
  First
   A11Q_2549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2579858..2580706
Genome map
AA seq 282 aa AA seqDB search
MSEQNHQPRTPPLAPHFLKIFLPINLLAPFALYLFIANFSWMNLLILIIGWLCIGGYGIA
VGYHRLLSHKAFLTPKWVERVLTFFGLFAGQGSSLFWVAVHRGLHHPYADTEKDLHSPIH
GNFMAYVGWQMYLNPSKVTFKQCRDLLQDPYQVFLHKHYNKIFWTVIVLATLIDWRLGLF
GFVLPSFISMHTENCVDLFCHKRNLGYRNYDINDNSTNIWWLGYFGFGQGWHNNHHNRPY
THYYSEKWWELDLTRLMIWPIKLRKKSGAPAKPAPAVQTQTT
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaaaaccatcagccacgaacacccccactagctcctcactttctaaaaatc
tttctgccaattaatttgctagcaccatttgctctttatctttttattgcgaatttcagt
tggatgaaccttttgatcttgatcatcgggtggctctgcatcggtggatatggtattgcc
gttggttaccatcggcttttatcacacaaagcttttttaactccgaagtgggttgaaaga
gtgctgactttctttggtctttttgcaggacagggctctagtttattttgggttgctgtc
catcgcggattacatcacccctatgccgataccgaaaaagatctgcacagtcctattcat
ggaaacttcatggcctatgtcggttggcagatgtacttaaatccatctaaggtcacattc
aaacagtgccgtgatcttttacaagatccctatcaggtcttcttacacaagcactacaac
aagattttctggactgtgattgttctggcaactcttatcgactggcgcttaggcctcttc
ggctttgtactgccttcttttatttcgatgcacacggaaaactgtgtggatcttttctgt
cataaaagaaatctgggctatcgcaattatgatatcaacgacaactccactaatatttgg
tggctcggctacttcggctttggacaaggctggcacaacaaccatcacaataggccttac
acgcactactactcagaaaaatggtgggagctagatttaactcgtctgatgatttggcca
atcaaactgcgcaaaaaatcgggcgctccagcaaagcccgcacccgccgtgcagacacag
acaacttag

DBGET integrated database retrieval system