KEGG   Bacteroides fragilis YCH46: BF1142Help
Entry
BF1142            CDS       T00202                                 

Definition
type III restriction-modification system restriction subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bfr  Bacteroides fragilis YCH46
Brite
Enzymes [BR:bfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     BF1142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1370479..1373511)
Genome map
AA seq 1010 aa AA seqDB search
MKLKFKHQKFQEDAAKAVCDVFGGQPYKMFDYQVETRKKDGQTSFEKFTGFRNHPIVPQL
TDEIVLKHIRDIQRAQQIKPSEALEGKYNLTIEMETGVGKTYTYIKTIFELNKRYGWCKF
IIVVPSVAIREGVHKSLEIMKEHFASDYSTPLSYFIYDSKQLGELNAFVTDSKIHVMIIN
SQKFNATNKDARRIYMKLDDFGGNCPIDVIAQMNPILIIDEPQSVEGAKTKEGLKRFNPL
FTLRYSATHRELYNLVYRLDAMEAYNLQLVKKIAVKGISISGTTATEGFVYLEGLNLYPD
KNPTANIGFEVKRTKAVNQVVRALKINDDLYAKSNHLEEYRNDYVITDINGVEDSVTFRN
GIKLYAGDVAGSVNETQLRRIQIRETILSHIEKEQELFEKDIKVLSLFFIDEVAKYRRYN
PDGKGEYAEIFEQEYTDIIKHLDLSLFNQPEYIDYLKSTVASKAHEGYFSKDKKGKLIDS
KTERGTKESADEDAYDLIMKNKERLLDRKEPIRFIFSHSALREGWDNPNVFQICTLKQSS
AEVRKRQEVGRGLRLCVNGQGDRMDANALGVEVHRVNLLTVIASESYESFAKGLQTEMAE
AIADRPQKVTIQLFKDQSLRLANGETIIATEDIAQSIYDSLLENKYIKKGELTDKFYEDR
KQGEVIFDDELTDYKASIMTILASIYNPREMQPNDARKSKINLRLSKDKLENSKLQELLK
LLCSKSTYTVKFDEKELVERAIESLNEKLRVSQLYLSVITGQMEKIKSKAALISGEAFKV
DANQAHYEKIDAMANDQVKYDLLGKLTDATNLTRQAVAQILSRIKPNVFGQFKNNPEDFI
IKASELINEEKACLIVKHIEYTPIDQYYDVSVFTRATIQGRLGVNTIKADKHLYDHVRFD
SQNEKTFMERLEENDEIEAYVKLPGNFYIPTPMGKYHPDWAIVFKQKLSKYPYFIAETKA
SDSSLQDRRIEEAKIECAKKHFAKTNGGKLKYNKVSSFEELLKIVTQESV
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaattcaaacatcagaagtttcaggaagacgcagcaaaagcggtatgtgat
gtctttggcgggcagccatacaagatgttcgactatcaagtagagacccggaagaaagac
ggacagaccagctttgaaaagtttacaggattccgtaaccaccctatcgtacctcaactc
acagatgagatcgttctgaaacacatccgggatatccagcgtgcccaacaaatcaaaccg
tcggaagcgctggaagggaaatacaatctcaccatcgaaatggagacgggtgtaggtaaa
acgtatacctacatcaaaaccatctttgaactgaacaaacgctacggttggtgcaagttc
atcattgtcgtacccagtgttgccatccgcgaaggagtccacaaaagcctggagattatg
aaggaacactttgcctcggattacagcacccctctgtcttatttcatctacgactccaaa
cagttgggtgaattgaacgcatttgtcacagacagcaaaatccatgtaatgatcatcaat
tcacagaagttcaatgcaacgaacaaagatgcccgccgcatctacatgaagctggatgat
tttggcggaaactgtcccatcgatgtgattgcgcagatgaatccgatactgattatcgac
gaacctcagtcagtagaaggagccaaaacaaaagagggattgaaacgattcaatcccctg
ttcacactgcgttattcggctacacaccgcgaactctataatctggtctatcgcctggac
gcaatggaagcttacaacctgcaactggttaagaaaatcgctgtcaagggtatctctatc
agtgggacaacagctactgaaggattcgtttatctggaaggtttgaacctgtatccggac
aaaaacccgactgccaatatcggattcgaagtaaaaagaaccaaagcagtgaatcaggta
gtacgagctctgaagataaatgatgacttgtatgctaaatcaaaccatctggaagaatac
cggaacgactatgtaattacagatatcaacggcgttgaagactccgtcaccttccggaac
ggcatcaaactttatgcaggtgacgtagcgggtagcgtcaacgaaacccaactacgacgt
atccagatacgggaaaccatcttgtcacacatagaaaaagaacaggaactgtttgagaaa
gacatcaaagttctctcccttttcttcatcgatgaagtagccaaataccgccggtataac
ccggacggaaagggagaatatgccgagattttcgaacaggaatataccgatatcataaag
cacctggatctttcgttattcaatcagccggaatatatcgattacctgaaatcgactgtg
gcatcgaaagctcacgaaggatacttctccaaagataaaaaaggaaaactgattgacagt
aaaaccgagcggggaaccaaagaatcggcagatgaagatgcttacgatttgattatgaag
aataaagaacgtctgcttgaccggaaagagccgatccgctttattttctcacattccgct
ctgcgggaaggatgggacaacccgaatgtctttcagatctgtaccctgaaacaaagttcg
gcagaggtacgcaagcgtcaggaagtgggacgagggctgcgcctctgtgtaaacggacag
ggagatcgcatggacgccaacgctttaggcgtagaagtgcatcgtgtcaacctactgacc
gtgatagccagcgaatcgtacgaatcgtttgccaaaggcttacagacagaaatggcggaa
gccatagccgaccgtccacagaaagtaaccatccaattattcaaggaccagtcgctccga
ttagctaacggtgaaaccatcatagccaccgaagatatagcacaaagtatctacgactct
ttacttgaaaacaagtacatcaagaaaggagaactgacagacaaattctatgaagaccgt
aaacagggagaagtgattttcgacgacgagctcaccgattataaggcgtctatcatgacc
atcctggcctctatctataatccaagggagatgcagccgaacgatgcaaggaaaagtaag
ataaatcttcggttgtcaaaagataaacttgaaaacagcaaacttcaggaactgttaaag
ctgctatgcagtaagtcaacctacaccgtaaagtttgacgaaaaagaattggtagagaga
gcgatcgaaagtttaaatgaaaagttaagagtatcccagctctatctttctgtcattacg
ggccaaatggaaaaaatcaagtccaaagcagctttaatttcgggagaggcatttaaggta
gatgccaatcaggcgcactatgaaaagatagatgccatggcaaacgatcaagtaaaatat
gacttgctcggtaaactcacagacgccaccaatctgacccgacaggcagttgctcagatt
ctctcccggataaaaccgaatgtattcggccaattcaaaaacaatcccgaggattttatt
atcaaggcttcggaactgattaatgaagaaaaagcatgtctgatagtaaaacatatcgaa
tataccccaatcgaccagtactatgatgtatcggtctttacccgggcaactattcagggg
cgtttgggagtaaacacaataaaagcagataaacatctgtacgatcatgtgagattcgac
tcccaaaatgaaaaaacattcatggaaagactggaagaaaatgacgaaatagaagcttat
gtaaaactacccggcaatttctatatccctactccgatgggaaaataccatccggactgg
gccatcgtcttcaaacaaaagttatcgaagtatccttattttattgccgaaaccaaagcc
agcgattcctccctacaagatcggagaatagaagaggcaaagatcgaatgtgccaaaaaa
cattttgcgaagacaaacggtgggaagcttaaatataataaagtaagctccttcgaagaa
ctcttgaaaatcgtcacacaagaatccgtttaa

DBGET integrated database retrieval system