KEGG   Burkholderia sp. CCGE1002: BC1002_0606Help
Entry
BC1002_0606       CDS       T01217                                 

Definition
bis(5'-nucleosyl)-tetraphosphatase (EC:3.6.1.41)
Orthology
K01525  
bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [EC:3.6.1.41]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BC1002_0606
Enzymes [BR:bge01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.41  bis(5'-nucleosyl)-tetraphosphatase (symmetrical)
     BC1002_0606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(671550..672422)
Genome map
AA seq 290 aa AA seqDB search
MTPHNASSTSAPLVPLAFGDLQGCRAPFQQLLAKAAPPDGTPLWFAGDLINRGPDSLDTL
RDVIAFGERAVPVLGNHDLHLLSVSAGIRKSKKGDTIEDILAAPDAADLLEWIRHRPLAH
FDNGMLMVHAGVLPQWDTTLTLELADELQRALRAPDWKETLAGLYGNEPNRWKPGLKGIE
RLRVTCSALTRMRFCSADGVMDFSSSGTLASTPSGCMPWFDVPSRQTADVTVVFGHWAAL
GLMLRDNLIGLDSGCVWGQKLSAVRLAPNPAERTLTQVDCDSCGVPRGGN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgacaccccacaacgcttccagtacgtccgctcctctcgttccgcttgctttcggcgat
ctgcaaggctgccgtgcgccgtttcagcaactgctcgccaaagccgcgccgccggacggc
acaccgctgtggttcgccggcgatctgatcaaccgcggccccgactcgctcgacaccttg
cgcgacgtgatcgcgttcggcgagcgcgcggtgccggtgctcggcaatcacgatctgcat
ctgctgtcggtgtcggcggggattcgcaagtcgaagaaaggcgacacgatcgaagacatc
ctcgctgcgcccgatgccgccgatctgctcgaatggatacgccaccggccgctcgcgcat
ttcgacaacggcatgttgatggtgcatgcgggcgtgttgccgcaatgggatacgacgctg
acgctggaactcgccgacgaattgcaacgcgcgctgcgtgcgccggactggaaagaaacg
cttgccggcctgtacggcaacgagccgaaccgctggaagccgggcctgaagggaatcgag
cgtctgcgtgtcacgtgcagcgcgttgacgcgcatgcgcttttgcagcgccgacggggtg
atggatttcagcagcagcggcacgctcgcatccacgccgagcggctgcatgccgtggttc
gacgtgccgtcgcgccagaccgccgacgtgaccgtggtgttcggtcattgggccgcgctc
ggcctgatgttgcgcgacaacctgatcggcctcgactcgggttgcgtgtgggggcagaag
ctgtcggcggtacggctcgcgccaaatccggcggagcgcacgttgacgcaagtcgattgc
gattcgtgcggcgtgccgcgcgggggcaattaa

DBGET integrated database retrieval system