KEGG   Burkholderia sp. CCGE1003: BC1003_3061Help
Entry
BC1003_3061       CDS       T01314                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BC1003_3061
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BC1003_3061
Enzymes [BR:bgf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BC1003_3061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3566457..3568016)
Genome map
AA seq 519 aa AA seqDB search
MSALREHHPSHQQIADALDWLRARVQPGAHLHADTRSLGAGDAFFAYAVEGADNRPFIDA
ALERGAAAVLVQPEGFSGALDASSMLAVPRLNELAGSIASAWYGDPSDHMLTVGVTGTNG
KTSCSQWISAALTALGTRCAIIGTLGTGLPGHLVHTGFTTPDAPQLQRSLAQLRDAGAKA
VAMEVSSHALHQGRVNGTAFDIAVFTNLTQDHLDYHRTFEAYEAAKARLFAWPELRAAVI
NRDDAVGRRLLASTRGHARTIAYGLDAGQADPSQAAQQADAFLLAANVRATATGTAFHLS
TSDWGEADVEVQTLGAFNVSNLLGVLGALLAANVPFDAALAELAKLESVNGRMQRLGGRL
QNDEPLVVIDYAHTPDALEKTLEALRPMAAARGGELICMFGCGGDRDATKRPLMGAIAEK
LADGVVVTSDNPRSEDPQSIIGQIAAGMKDASKARRIEDRASAILQAIRSAAREDVIVLA
GKGHEATQEIMGKKRAFSDQDHARLALAARATQARGGGE
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgctccgtgaacatcacccgtcccaccagcagattgccgacgcgttggactgg
ctgcgcgcgcgcgtgcagccaggcgcgcatctgcacgccgatacccgttcgctcggggcg
ggcgacgcgtttttcgcctatgcggtggaaggcgcggacaaccggccgttcatcgacgcc
gcgctcgagcgcggcgctgccgcggtgctcgtgcagccggaaggattcagcggcgcactc
gacgcatcctcgatgctcgcggtgcctcgcctgaacgagcttgccggttcgatcgccagc
gcctggtacggcgatccgagcgaccacatgctgaccgtcggcgtgacgggcaccaacggc
aagacttcgtgcagccagtggatttcggcggcgctcacggcgctcggcacgcgctgcgcg
atcatcggcacgctcggcacgggtttgccggggcacctcgtgcacaccggcttcacgacg
cccgacgccccgcagttgcaacgcagcctcgcgcagttgcgcgacgccggcgcgaaggcc
gtggcgatggaagtctcctcgcatgcattgcaccaggggcgcgtgaacggcacggcgttc
gacatcgccgtgttcacgaatctcacgcaagatcatctggattatcaccgcacgttcgaa
gcatacgaagcggcgaaggcgcgcctgttcgcgtggccggaactgcgcgcggccgtgatc
aaccgcgacgacgcggtcggccgccgtctgctcgcgagcacgcgaggccacgcgcgcacc
atcgcttacggtctcgacgccgggcaggctgacccgtcgcaagccgcacagcaagcggac
gcgtttctgctcgccgccaacgtgcgcgcgaccgccacgggcaccgcgttccatctgagc
acgtccgactggggcgaggccgacgtcgaagtgcagacgctcggcgccttcaacgtgagc
aatctgcttggcgtgctcggcgcgctgcttgccgcaaacgtgcccttcgacgccgcgctc
gccgagctggcgaagctggagtcggtaaacggccgcatgcagcgcctgggtggccgcctg
cagaacgatgagccgctcgtcgtgatcgactacgcgcacacgccggacgcgctggaaaaa
acgctcgaagcgctgcggccgatggcagcggcgcgcggcggcgaactgatctgcatgttc
ggttgcggcggcgaccgcgacgcgaccaagcgtccgctgatgggcgcgattgccgagaag
ctcgcggacggcgtcgtcgtcacgagcgacaacccgcgcagcgaagatccgcagtcgatc
atcgggcagattgcagcgggcatgaaagacgcgtcgaaggcgcgccgcatcgaagatcgc
gcgagcgcgatccttcaggcgatccgcagcgccgcgcgcgaagacgtcatcgtgctcgcc
ggcaaggggcacgaggcaacacaggaaatcatgggcaagaaacgcgctttctccgaccag
gaccacgcccgtctcgcgctcgccgcgcgggcgacgcaggcacgcggaggtggcgaatga

DBGET integrated database retrieval system