KEGG   Burkholderia glumae BGR1: bglu_1g04360Help
Entry
bglu_1g04360      CDS       T00905                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bgl  Burkholderia glumae BGR1
Pathway
bgl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bgl01100  Metabolic pathways
bgl01110  Biosynthesis of secondary metabolites
bgl01130  Biosynthesis of antibiotics
bgl01230  Biosynthesis of amino acids
Module
bgl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bgl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bglu_1g04360
Enzymes [BR:bgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     bglu_1g04360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACR27634
UniProt: C5AAB2
Position
1:complement(453881..454672)
Genome map
AA seq 263 aa AA seqDB search
MSDILNRIIAVKREEIAAGLRSTPLEALRLEAEARGADTRDFVGALRAQHAAGRSAVIAE
VKKASPSKGVLREHFVPAEIAASYARHGAACLSVLTDEQFFQGGARYLREAREACALPVL
RKDFIIDPYQVLEARAMGADAILLIAAALDTPQMQDLEAYAHSLGLAVLVEVHDRDEMAN
ALTLKTPLIGINNRNLRSFETTLDTTLGMLEMVPAERIVVTESGIRTRDDVERMRRAGVH
TFLVGEAFMRAEQPGEELARMFF
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctcaatcgaatcattgccgtcaaacgcgaagaaatcgccgccgggctg
cgcagcacgccgctcgaggcgctgcggctcgaagccgaggcgcgcggcgccgacacgcgc
gacttcgtcggcgcgctgcgcgcgcagcacgcggccggccgcagcgccgtgatcgccgaa
gtgaagaaggcgagcccctcgaaaggcgtgctgcgcgagcacttcgtgccggccgaaatc
gccgcctcctacgcacggcacggcgcggcctgcctgtcggtgctgaccgacgaacagttc
ttccagggcggcgcgcgctacctacgcgaggcgcgcgaggcctgcgcgctgccggtgctg
cgcaaggacttcatcatcgacccgtaccaggtgctcgaggcgcgcgcgatgggcgccgac
gcgatcctgctgatcgccgcggcgctcgacacgccgcagatgcaggacctcgaagcctat
gcgcactcgctcggcctcgcggtgctggtcgaagtccacgatcgcgacgagatggccaat
gcgctgacgctgaagacgccgctgatcggcatcaacaaccgcaatctgcgcagcttcgag
accacgctcgacaccacgctcggcatgctcgagatggtgccggccgagcgcatcgtcgtg
accgaatcgggcatccgcacgcgcgacgacgtcgagcgcatgaggcgcgcgggcgtccat
acgttcctcgtcggcgaggcgttcatgcgcgccgagcagccgggcgaagaactcgcgcgg
atgttcttctga

DBGET integrated database retrieval system