KEGG   Bacillus halodurans: BH0632Help
Entry
BH0632            CDS       T00039                                 

Gene name
purN
Definition
phosphoribosylglycinamide formyltransferase
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
bha  Bacillus halodurans
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BH0632 (purN)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BH0632 (purN)
Enzymes [BR:bha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     BH0632 (purN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
686074..686640
Genome map
AA seq 188 aa AA seqDB search
MKRVAIFASGSGTNAEAIIQSQKAGQLPCEVALLITDKPGAKVVERVKVHEIPVCALDPK
TYPSKEAYEIEVVQQLKEKQIDFVVLAGYMRLVGPTLLGAYEGRIVNIHPSLLPAFPGLH
AIEQAIRANVKVTGVTIHYVDEGMDTGPIIAQEAVSIEEEDTLETLTTKIQAVEHRLYPA
TLHKLLSK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgagtagccatctttgcttccggtagcgggacgaatgccgaagcgattattcag
tcacaaaaggcagggcagcttccctgtgaagtcgctcttttaatcacggataaacccggg
gcaaaagtggtggagcgtgtaaaggttcacgaaattcctgtctgtgcattagacccaaaa
acgtatccatctaaggaagcgtatgaaatagaagttgtccagcagctaaaggaaaaacag
atcgattttgttgtgttagcaggttatatgcgtctagtgggaccgacgttgcttggagcg
tatgaggggcgaattgtgaacatccatccatcgctcttacctgcatttccaggactccat
gcgatcgaacaagcgataagggcgaacgtgaaagtaacaggcgtcacgatccattacgta
gatgaaggaatggatactgggccgattatcgcccaggaagccgtttcgattgaagaggaa
gatactcttgaaacgttaacaacgaaaattcaagcagtcgagcacaggctttatccagcc
acgttgcacaagctgctttcaaaataa

DBGET integrated database retrieval system