KEGG   Bacillus halodurans: BH0899Help
Entry
BH0899            CDS       T00039                                 

Definition
endo-1,4-beta-xylanhydrolase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bha  Bacillus halodurans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
972034..972666
Genome map
AA seq 210 aa AA seqDB search
MFKFVTKVLTVVIAATISFCLSAVPASANTYWQYWTDGGGTVNATNGPGGNYSVTWRDTG
NFVVGKGWEIGSPNRTIHYNAGVWEPSGNGYLTLYGWTRNQLIEYYVVDNWGTYRPTGTH
RGTVVSDGGTYDIYTTMRYNAPSIDGTQTFQQFWSVRQSKRPTGNNVSITFSNHVNAWRN
AGMNLGSSWSYQVLATEGYQSSGRSNVTVW
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagttcgttacgaaagttttgacggtagtaattgcagctacaattagtttttgt
ttgagtgcagtaccggcaagtgctaatacctattggcaatattggaccgatggtggtgga
acagtaaatgctacaaatggacctggtggaaattacagtgtgacatggagagatacaggg
aactttgttgtcggtaaaggttgggaaatcggttcaccaaatcgaacgatccattacaat
gctggtgtttgggaaccgtctggaaatggatatttgactctctatgggtggacaaggaat
cagctcatagaatattatgtcgttgataattggggaacttacagacctactggaacccat
cgaggcaccgttgtcagtgatgggggaacatatgatatctatacgactatgcgatacaat
gcaccttccattgatggcacacaaacgttccaacagttctggagtgtgaggcaatcgaag
agaccgactggaaataacgttagcattacgtttagcaaccacgtgaatgcgtggagaaat
gcaggaatgaatctgggaagtagttggtcttaccaggtattagcaacagaaggctatcaa
agtagcgggagatcgaatgtgacggtttggtag

DBGET integrated database retrieval system