KEGG   Beijerinckia indica: Bind_0498Help
Entry
Bind_0498         CDS       T00688                                 

Gene name
truA
Definition
tRNA pseudouridine synthase A (EC:5.4.99.12)
Orthology
K06173  
tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
bid  Beijerinckia indica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
555948..556730
Genome map
AA seq 260 aa AA seqDB search
MPRYKLTVEYDGASFVGWQRQKNGLSVQEVIETALLAINGAPVGIRGAGRTDAGVHASAQ
VAHADLAREWRPDVLRDALNAHMRPALVAVVAAEPVPETFDARFSAIRRHYLYRIINRRA
PLTFEAGRAWLVKRRLDARAMHEAAQVLTGRHDFSTFRAAECQAASPIRTLERLDVQAVG
DLIEIRASARSFLHHQVRSMVGSLEMVGSGKWSAGDLRAALEACDRRRCGMVAPAAGLYL
TGVDYPEEGEEKGAQPFFGE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgccccgctataaattaactgtcgaatatgacggcgcgtcctttgtgggttggcagagg
cagaagaatgggctctcggttcaggaagtgatcgagacggctctcttggccatcaatggc
gcgccggttggcattcgcggagcgggccgcacggatgccggcgttcatgcgagtgctcaa
gtggcccatgccgatcttgcgcgggaatggcgtcccgatgtcctgcgcgatgccttgaac
gcgcatatgcgtccggctttggtcgctgtcgtggcggcggaacctgtcccggaaacgttc
gacgcgcgcttttcagccatccgccggcattatctctaccgtatcatcaatcgccgtgcg
cctctgacctttgaggcggggcgcgcctggctggttaaacgccggctcgatgcgcgagcc
atgcatgaagcggcgcaagtcctgaccggacgccatgatttttcgacctttcgggcggcg
gaatgccaggcggcgagcccaatccgcacgctggagcgtttggacgtgcaagccgtgggc
gatctcatcgaaatccgggcgagcgcgcgatccttcctgcatcatcaggtgcgctcgatg
gtggggtcgctcgaaatggtcggttccggcaaatggagcgcaggggatctgcgggcggct
ctggaggcctgtgatcggcgccgttgtggcatggtcgctccggccgccggcctttatctg
accggggtcgattatcctgaagaaggagaagaaaaaggggctcagccctttttcggcgaa
tag

DBGET integrated database retrieval system