KEGG   Bradyrhizobium diazoefficiens USDA 110: blr1159Help
Entry
blr1159           CDS       T00109                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    blr1159
   00630 Glyoxylate and dicarboxylate metabolism
    blr1159
   00640 Propanoate metabolism
    blr1159
   00650 Butanoate metabolism
    blr1159
  Lipid metabolism
   00071 Fatty acid degradation
    blr1159
   00072 Synthesis and degradation of ketone bodies
    blr1159
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    blr1159
   00310 Lysine degradation
    blr1159
   00380 Tryptophan metabolism
    blr1159
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    blr1159
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    blr1159
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    blr1159
Enzymes [BR:bja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     blr1159
Exosome [BR:bja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   blr1159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
1277010..1278218
Genome map
AA seq 402 aa AA seqDB search
MADAYIYDHVRTPRGRGKADGALHEVTALALAAVPLKALKDRNNLPEDCVDDVVLGVVDP
VGEAGSDIARFAALKAGLGEAVPGVQISRFCASGLDAVNFAAAQVMSGQHELVIGGGAES
MSRVGIGASGGAWPMDPSMAVPAYFMPQGVSADLIATKYGFSRDDVDAYAVQSQQRAGKA
WDEGRFNKSVVPVKDINGLTILAKDEHMRPSTTMQSLAQLQPAFTMMAQMGGFDGVAVQS
HPEIERVNYVHHAGNSSGIVDGAGAVLLGSKDAGSKYGLKPRAKIRAFANIGSEPAMMLT
GPVDVTEKLFARSGMKKSDIDLFELNEAFASVVLRYIQAFDIDNAKINVNGGAIALGHPL
GATGAMILGTVLDELERTNKSTALVTLCIGGGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgcctacatctacgaccacgtccgaaccccgcgcggccgcggcaaggcggac
ggcgcgctgcacgaagttaccgcgctggcgctcgccgcggtgccgttgaaggcgctgaag
gaccgcaacaatctgccggaagattgtgtcgacgacgtcgtgctcggcgtggtcgatccc
gtcggtgaagcaggcagcgacatcgcgcgtttcgccgcgctgaaggcgggcctcggcgaa
gccgtgccaggcgtgcagatcagccgcttctgcgcctccggtctcgatgccgtgaacttt
gcggccgcgcaggtgatgagcggccagcatgagctcgtcatcggcggcggtgccgaatcg
atgagccgcgtcggcatcggcgcctccggcggcgcctggccgatggatccctcgatggcg
gtgcccgcctatttcatgccgcagggcgtctcggccgatctgatcgcgacgaagtacggc
ttctcgcgtgacgacgtcgacgcttacgccgtgcagagccagcagcgcgccggcaaggcc
tgggacgaaggccgcttcaacaagtcggtcgtgccggtgaaggacatcaacggcctcacc
atcctcgccaaggacgagcacatgcgtccttcgacgacgatgcagtcgctggcgcagctt
cagccggcgttcacgatgatggcgcagatgggcggcttcgacggcgtcgcggtgcagtcg
caccccgaaatcgagcgcgtcaattacgtgcaccacgccggcaactcgtcgggcatcgtc
gacggcgccggcgccgtgctgctcggcagcaaggacgcgggcagcaaatacggcctgaag
ccgcgcgcaaaaatccgcgcgtttgcgaacatcggctccgagcccgcgatgatgctgacc
ggtccggtcgacgtcaccgagaagctgttcgcgcgctccggcatgaagaagtcggacatc
gacctgttcgagctcaacgaggccttcgcctcggtcgtgctgcgctacatccaggccttc
gatatcgacaacgccaagatcaacgtcaacggcggcgcgatcgcgctcggccatccgctt
ggcgcgaccggtgcgatgatcctcggcaccgtgctcgacgagctcgagcgcaccaacaag
tccactgcccttgtgacgctgtgcatcggcggcggcatgggcaccgcgaccatcatcgag
cgcgtctaa

DBGET integrated database retrieval system