KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2780Help
Entry
blr2780           CDS       T00109                                 

Definition
NAD-dependent alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    blr2780
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    blr2780
  Lipid metabolism
   00071 Fatty acid degradation
    blr2780
  Amino acid metabolism
   00350 Tyrosine metabolism
    blr2780
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    blr2780
   00626 Naphthalene degradation
    blr2780
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     blr2780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3058723..3059790
Genome map
AA seq 355 aa AA seqDB search
MKSFKVADFKAPLQEFDEPTPQPSGTQVLIKVKAAGVCHSDLHIWEGGYDLGHGRKPLSL
KDRGINLPLTMGHETVGEIVAFGPDVKPTDQGDLRLGDVGLVYPWIGCGKCATCLGGDEN
MCLTPRSLGVYCDGGYSDHMLVPHPRYLLNLKGLDPATTAPYACSGVTTYSALKKVEQHF
DTPIVMFGAGGLGLMALSLLKAMGGKGAIMVDIDARKREAAEKAGALATVDPKAPDALEQ
LAKKAGGPIRAVIDLVGNAATTQLGFDCLTKGGKLVIVGLFGGGATWALPLIPIKAVTIQ
GSYVGNLRETQELLDLVRTKNVPPIPVTRQPLAKANDALVQLQQGAVVGRTVLTP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtttcaaggtcgccgatttcaaggcgccgctgcaggagttcgacgagcccacg
ccgcagccgtcgggcacgcaggtgctgatcaaggtgaaggccgccggcgtctgccacagc
gacctccatatctgggaaggcggttacgatctcggccatggccgcaagccgctgtcgctg
aaggaccgcggcatcaatctgccgctgaccatgggccacgagacggtcggtgaaatcgtg
gctttcggtcctgacgtgaagccgaccgaccagggtgatctcaggctcggcgatgtcggc
ctggtctatccctggatcggctgcggcaagtgcgcgacctgccttggcggcgacgagaac
atgtgcctgacgccgcgctcgctcggcgtctattgcgacggcggctattccgatcacatg
ttggtgccgcatccgcgctatctgctgaacctcaaagggctcgatcccgcgaccaccgcg
ccctatgcctgctcgggcgtcaccacctacagtgcgctgaagaaggtcgagcagcatttc
gacacgccgatcgtgatgttcggcgccggcggcctcggcctgatggcgctgtcgctgttg
aaagcgatgggcggcaagggcgcgatcatggtcgacatcgacgccaggaagcgcgaggcg
gcggagaaggccggcgcgcttgcgaccgtcgatcccaaggcgccggacgcgctggagcag
cttgccaagaaagcgggcgggccgatccgcgccgtcatcgacctcgtcggcaatgccgcg
acgacgcagctcggcttcgactgcctgaccaagggcggcaagctcgtcatcgtcggcctg
ttcggcggtggcgcgacctgggcgctgccgctgattccgatcaaggcggtgaccatccag
ggcagctatgtcggcaatctgcgcgagacgcaggaactgctcgacctcgtgcgaacgaag
aacgtgccgccgatcccggtgacgcgtcagccgctcgccaaggccaacgacgcgctggtg
cagttgcagcagggcgccgtggtcggacgcacggtgctgacgccgtag

DBGET integrated database retrieval system