KEGG   Bradyrhizobium japonicum USDA 6: BJ6T_67070Help
Entry
BJ6T_67070        CDS       T01848                                 

Definition
6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bju  Bradyrhizobium japonicum USDA 6
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bju00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BJ6T_67070
Enzymes [BR:bju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BJ6T_67070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6866928..6867419
Genome map
AA seq 163 aa AA seqDB search
MASVLIALGGNVGDVRATFRKAISHICGMAQAALIARSSDYATPPWGDEDQDPFINACVE
IETSLDPHALLFVMQKVEQKFGRTRNKERQWGPRTLDLDLIAYDDVSLQKPDLTLPHPRL
FERAFVLVPLAEIAPDRVISGIRVRDGLASVSTQGIERLPDTG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgtcctcattgcactcggcggcaatgtcggcgatgtccgcgcgacgttccgg
aaggcgatctcgcacatctgcggcatggcgcaagccgcgctgatcgcgcgctcctcggac
tatgcgacgccgccctggggcgacgaggaccaggatcccttcatcaatgcctgcgtcgag
atcgagaccagcctcgatccgcatgcgctcctgttcgtgatgcagaaggtcgagcagaaa
ttcggccgcacacggaacaaggagcggcaatggggcccgcgcacgctcgatctcgacctg
atcgcctatgacgatgtcagcttgcagaagcccgacctgaccttgccgcatccgcgcctg
ttcgagcgcgccttcgtgctggtgccgctggctgaaatcgcgcccgaccgcgtcatctca
ggcattcgtgtgcgtgacgggcttgccagcgtctcgacgcaaggtattgagcggcttccg
gataccggttaa

DBGET integrated database retrieval system