KEGG   Bifidobacterium longum subsp. longum BBMN68: BBMN68_1488Help
Entry
BBMN68_1488       CDS       T01345                                 

Gene name
rfbC
Definition
rfbc
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
blb  Bifidobacterium longum subsp. longum BBMN68
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:blb00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:blb00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1841255..1842682
Genome map
AA seq 475 aa AA seqDB search
MAFEFEKELKVEKTNIPGLLVFDLPVHGDNRGWFKENWQRAKMLKLGLPDFGPVQNNISF
NATKGVTRGIHAEPWDKYISIATGEIFGAWVDLRPGESFGQVFTTRLDPSRAIYVPRGVG
NSFQALEDGTAYTYLVNAHWSLEQKKTYTFVNLADPELNIQWPIPLEESERSEADLHHPM
LKDAKPMSPKRTMVFGCKGKLGRAIRRYADEHQLQGFEYHDTDTFDIADSHAYEGIDWDL
YGTIINAAAYTAVDKAETPEGRKAAWQTNVKGVGNLARVCTEHRITLIHISSDYVFDGSQ
ELHKEDEEFAPLGVYGQTKAAGDTLVENVPQHYLLRSSWVIGEGRNFVTRMIGLANNGEH
AEAPSDQFGRLTFTDDMAGAIFHLLDSGAAFGTYNMTGSGRVVSWYDIASIVFKAVGADE
NNLVANSVAEYAREHHAALRPRNCSLDLSKLEAAGYHPRNWEESLASYLTKELNK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaattcgagaaggaactgaaggtcgagaagacgaacatcccgggtctgttg
gtgttcgacctgccggtgcatggtgacaatcgtggctggttcaaggagaactggcagcgt
gcgaagatgctgaagctggggttgccggatttcggcccggtgcagaacaacatcagcttc
aacgcgacgaagggcgtgacgcgcggcatccacgcggagccatgggacaagtacatcagc
atcgcgaccggtgagatattcggcgcgtgggtcgatttgcgtccgggcgagagcttcgga
caggtgttcacgactcgtctggatccgagtcgtgcgatttatgtgccgcgtggcgtgggc
aacagcttccaggccctcgaagacggcaccgcgtacacgtatctggtgaacgcgcactgg
agcttggagcagaagaagacgtacacgttcgtgaacctcgcggaccctgaactcaacatt
cagtggcccatcccgctggaggagtccgagcgtagcgaggccgacctgcaccaccccatg
ctcaaggacgccaagcccatgagcccgaagcgcaccatggtgtttggttgcaaaggcaag
ttgggccgtgccatacgacgatatgcagatgagcatcaattacagggctttgagtatcac
gatactgatacgttcgatattgctgattctcatgcttatgagggtatcgactgggatctg
tacggcactatcatcaacgcggcggcatatactgccgtagacaaggcagagactcctgaa
ggtcgtaaggctgcgtggcagaccaatgtaaagggagtgggcaatctcgctcgtgtctgt
accgagcaccgtattacgctcattcatatttccagtgactatgtcttcgatggctctcaa
gaattgcataaagaagatgaagagttcgctccgctaggcgtgtatggccagactaaagct
gctggtgacacgctggtagagaatgtcccacagcactatctattgcgatccagctgggtt
attggcgaaggccgtaattttgtgactcgtatgattggcttggcaaataacggtgaacat
gcagaagctccttctgatcagtttggacgtctgacattcaccgatgacatggctggcgct
atcttccacttgctggattctggtgccgcattcggcacctacaatatgactggttctggc
cgtgtcgtaagctggtatgacattgcaagcattgtgttcaaagctgtcggagctgatgaa
aataatcttgttgccaattctgtcgccgaatatgcgcgagagcaccatgccgcattgcgg
ccgcgaaattgctctctcgatttaagcaaacttgaagcagcaggttatcatccccggaac
tgggaggaatccctcgcatcttatctcacgaaggagctgaataagtga

DBGET integrated database retrieval system