KEGG   Bifidobacterium longum subsp. longum F8: BIL_05230Help
Entry
BIL_05230         CDS       T02580                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
blg  Bifidobacterium longum subsp. longum F8
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:blg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BIL_05230
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BIL_05230
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BIL_05230
Enzymes [BR:blg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BIL_05230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(601691..602824)
Genome map
AA seq 377 aa AA seqDB search
MSTPSQAEVRRMIAAAGTIVVKVGSSSLTQPSGHLDPDKLDALAAALAQVRLMGGRVVLV
SSGAIAAGFGPLGFDSRPVDVATQQATAAVGQGLLMARYETAFGRFGIRVGQILITAEDT
IRATQYRNVERTLDRLLDLGVVPIINENDSLASNEIRFGDNDRLSALVANLVRAEALVLL
TDVDALYTAPPSQPGSRRVEYVPNVIDALGDIQVSGSGSKVGTGGMVTKLEAARVAAVSG
IPTVLTCASNAGPAMMGDPVGTVFAPVKARGSSRRLWIGFAADPRGTIVVDAGAGQAIRG
GRASLLAAGALEVHGDFSAGDPVWIDAESGEHLARGLAGFDSEEIPQMLGRNTAQLKRFL
GPQYAHPLVHRDNLVLV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcactccgagtcaggccgaggtgcggcgcatgatcgccgcagccggaaccattgtc
gtgaaagtcggctccagctcgctgacccagccgagcggtcacctcgacccggacaagctc
gacgcgttggccgcggccttggctcaggtccgattgatgggcggacgtgtggtgctggtc
tcgtccggtgctatcgccgccggtttcgggcctctgggctttgactcgcggccggtggac
gtggccactcagcaggccaccgcagccgtcggccaagggctactgatggcccgctacgag
actgcgttcggtcgattcggtattcgcgtcggccagattctgatcactgccgaagatacg
attcgtgccacccagtaccgcaatgtggaacgcacgctggaccgtctgcttgacctcggc
gtggtgccgatcatcaacgaaaacgattcgttggcctcgaacgagattcgcttcggcgac
aacgatcgactctccgcgttggtggccaacctggtgcgggccgaagccttggtgctactg
accgacgtggacgcgctgtacactgcgccgccctcgcagcccggctcccgccgtgtggaa
tatgtgcccaacgtgattgatgcgctgggcgacatccaagtctccggctccggctccaag
gtcggcaccggcggcatggtcaccaaactcgaggccgcgcgcgtggcggccgtctcgggc
atccccacggtactcacctgcgcctcgaacgcgggccctgcgatgatgggcgatccggtg
ggcaccgtgttcgcaccggttaaggcccgcggctcctcacgccgtctgtggatcggcttc
gccgccgacccgcgcggcacgattgtggtcgatgcgggtgccggccaggcgattcgcggc
gggcgtgcctcgctgctggcggccggcgcgctcgaagtacatggcgatttttccgccggc
gatccggtctggatcgatgccgaaagcggtgaacacctggcccgaggcctcgccggcttc
gattccgaagaaattccgcagatgctcgggcgtaacaccgcccaactcaagcgtttcctc
ggcccccagtacgcccacccactggttcatcgcgacaatctcgtgctcgtgtga

DBGET integrated database retrieval system