KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_01153Help
Entry
BLNIAS_01153      CDS       T01845                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
blk00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BLNIAS_01153
Enzymes [BR:blk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BLNIAS_01153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AEI97339
UniProt: F8APU5
Position
943531..944523
Genome map
AA seq 330 aa AA seqDB search
MVISEEEHEQMPEPVRERLEALKDAPGSVIVVGSMNADYTVTTKRLPKPGETVNGGAMKV
LPGGKGANQASAAARLGVNVQLLGAVGEDSNADFLLSKLDEAGVDTADILHVEGPSGATV
ITVSAEGENTIVYSPGSNAKASAGYVQSHRTTIAECAVLGLCLESPIATVIAAAQTAHDA
GVTVLLNDSPFMDELPHELVEATDILLVNQHEVAQLLGLPDDDVESLDWYEVAERFTDYG
FDRAIVTLGASGSVVIENGRWHRVSAAQVNAVDTTGCGDSFMGTVLAGLAAGHTLLQSAQ
IGSYVSAYAATKLGAQSAYGTAEEVIAYFS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggtgataagtgaagaagaacatgaacagatgcccgagcccgtacgggaacgattggaa
gcgctgaaggatgcgccgggctcggtaatcgtggtcggctcgatgaacgccgattacacc
gtaaccactaaacgactacccaagccaggtgaaaccgtcaatggtggtgccatgaaagtg
ctgccgggcggcaagggcgcgaatcaggcgtctgccgccgctcgtctcggtgtcaatgtc
cagttgctgggcgcggtgggcgaggactccaacgcggacttcctattaagcaagctggat
gaggccggcgtcgacaccgccgatatcctgcatgtcgaaggccccagcggcgccacggta
atcaccgtgagcgctgagggcgagaacaccatcgtctattcgccgggttccaatgccaag
gcaagtgccggctatgtgcaatcacatcgcacgaccatcgccgaatgcgcggtattggga
ctgtgtctggagagcccgattgccaccgttatcgccgccgcgcagaccgcgcatgacgct
ggcgtgaccgtgctgctcaacgactcgccatttatggacgagctgcctcacgaactggtg
gaagccacggatattctgctggtcaaccagcatgaagtggctcaactgctgggcctgccg
gatgatgacgtggaatcactcgactggtatgaggtcgccgaacgattcaccgattacgga
ttcgaccgggcgatagtgacgcttggtgcgtcgggatcggtggtgatcgagaacggacgt
tggcatcgcgtatccgccgcgcaagtcaatgcagtggacaccaccggttgcggcgactcg
ttcatggggaccgtgctggctggcttggccgccggtcatacgctgctgcaatccgcgcaa
atcggctcctacgtctccgcctatgcggccaccaagcttggtgcccaaagtgcctacggt
accgccgaagaagtcatcgcctacttcagctga

DBGET integrated database retrieval system