KEGG   Bacillus megaterium DSM 319: BMD_0882Help
Entry
BMD_0882          CDS       T01219                                 

Gene name
sacP
Definition
(GenBank) phosphotransferase system (PTS) sucrose-specific enzyme IIBC component
  KO
K02809  PTS system, sucrose-specific IIB component [EC:2.7.1.211]
K02810  PTS system, sucrose-specific IIC component
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00500  Starch and sucrose metabolism
bmd02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BMD_0882 (sacP)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    BMD_0882 (sacP)
Enzymes [BR:bmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.211  protein-Npi-phosphohistidine---sucrose phosphotransferase
     BMD_0882 (sacP)
Transporters [BR:bmd02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Sucrose-specific II component [MD:M00269]
    BMD_0882 (sacP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC PTS_EIIB
Motif
Other DBs
NCBI-ProteinID: ADF37744
UniProt: D5DCC4
Position
864869..866230
Genome map
AA seq 453 aa AA seqDB search
MSLDNHQLAKVILEMLGGASNIEVYTHCMTRLRVTVKDDSIVKKADIRKLEGVLGLVEEE
TLQIIIGPGKVNKVTEEFGKLIDESGGINLENRAAQRKSEVKEKNATPFKLLLRRIASIF
IPLIPALVASGLITGVTKAAVQAKWLPADSQIAILLTVIGSGLFAYLGILVGINAAKEFG
GSPALGGLAGILVINPAVADIKLFGEALLPGRGGLIGVLLAAIFMAMLEKRVRKFVPQSL
DIIITPTVTVLITGIITYVVFMPIGGLISDGITKGLLGVLEIGGVVAGFVLGATFLPLVI
TGLHQGLTPVHLELINSIGDDPLLPILAMGGAGQVGAAFAIYIKTKKKRLKRAIGGALPS
GLLGIGEPLIFGVTLPLGRPFLTACLGAGIGGAFQAHFHIATVAVGVSGLPLAFLVHAHQ
ILLYLLGLVVAYAAGFVCTYFFGFNDEMAREFE
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtctttagataatcatcaattagcaaaggttattttggagatgcttgggggagcatcc
aatattgaagtgtatacgcattgtatgactcggctgcgcgtgactgtaaaagatgattcg
attgtaaaaaaggcagatatacgaaagcttgaaggcgtgctcggattagttgaagaagaa
acgctgcaaatcattattggtcctggaaaagtaaacaaagtaacagaggaattcggaaag
ttaattgatgaatccggcggtattaatttagaaaatcgtgcggctcagcggaaatcagag
gtgaaagaaaaaaatgcaactccgtttaagcttttgcttcgccgaattgcaagtattttt
attccgttaatacctgctcttgtagcatctggacttatcaccggagtgacaaaagcagca
gttcaagcgaagtggcttcctgcagattcacagattgctattctattaacggttatcgga
agcggcttatttgcttatcttggtattttagtaggtattaatgccgcaaaagaatttggt
ggttcaccggctctagggggcttagcgggtattttagtcattaatcctgccgtagctgat
attaaacttttcggtgaagcacttttgccgggtcggggtggcttaataggagtcttgctt
gcagcaatctttatggccatgttagaaaaacgagtacgcaaatttgtccctcagtcactg
gatattattattacaccaaccgttacggtattaattacaggcattattacgtatgtagta
ttcatgccaatcggcggcttgatttcagacggaatcacaaaaggtcttttaggagtttta
gagattggaggagttgtagcaggctttgtgttaggagcaacattcttgccgctcgtcatt
acaggactgcatcaaggtcttactcctgttcatttagagcttatcaattcaattggagat
gatccgcttcttcctatcctagcaatgggcggagctggtcaggtaggtgccgcttttgct
atttatatcaaaacgaagaaaaaacgtttaaagcgagcaattggaggcgctcttccttca
gggctgcttggaatcggagagccgcttatttttggagtcacacttcctttagggcgtcca
ttcttaaccgcttgtctcggagctggaatcggcggagcatttcaggcgcactttcatatt
gcaactgtagcagtgggggtatcaggtttgccgcttgcgtttttagttcatgcgcatcaa
attcttctttatttacttggattagttgttgcttatgcagcaggctttgtttgtacctat
ttctttggatttaacgatgaaatggcgagggagtttgaatga

DBGET integrated database retrieval system