KEGG   Bacillus megaterium DSM 319: BMD_1109Help
Entry
BMD_1109          CDS       T01219                                 

Definition
(GenBank) putative asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00250  Alanine, aspartate and glutamate metabolism
bmd01100  Metabolic pathways
bmd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMD_1109
Enzymes [BR:bmd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BMD_1109
Peptidases [BR:bmd01002]
 Cysteine Peptidases
  Family C44
   BMD_1109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_7 GATase_6 DUF3700
Motif
Other DBs
NCBI-ProteinID: ADF37970
UniProt: D5DBI8
Position
1088167..1088913
Genome map
AA seq 248 aa AA seqDB search
MSAITGIYTFNRTMPIEEGKSILKHLQRYYADSSSFWCKDSVFLGSHTRWITPESVGKSL
PYYDEEKRLVIVADCILDNREELAHILQLRTSDRNRLSDSQLILEAYQKWGEETPMHLLG
DFTFIIWDEKKKQLFGGRDFSGSRTLYFHKNHEQIAFCTVINPLLDLPIVKKNLNEEWLA
EFLAIPGMNDAVDAESTVYESIKQIPPSYSFSVNNGEMKLTQYSHITFQSPLVLKSTGEY
VEAFQEVF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaataacaggtatatatacctttaatagaacgatgccaattgaagaaggaaaa
tcaattttaaaacatcttcaacgttattatgcagatagcagcagtttttggtgtaaagat
tctgtgttcttaggctcacatacgagatggataactccagagtctgtgggaaaatcactc
ccttattacgacgaggagaagcggcttgtcattgttgcagattgcatattggataatcgt
gaagagttagcacatattcttcaattaagaacaagtgacagaaatcgattatcagacagt
cagctaattttagaggcctatcaaaagtggggagaagaaacgcctatgcatttgctagga
gactttacttttattatttgggatgaaaagaaaaaacaacttttcggaggaagagatttt
tccggcagccgcaccctatactttcataaaaatcatgaacaaattgcgttttgtacagtt
attaatccattactggatttaccaatagtaaaaaagaacttaaacgaagaatggttagcg
gaatttttagcgatacctggtatgaatgatgcggtggatgcagaatctacagtctatgaa
tctattaaacaaattcctccttcatattcattttcagttaataatggagaaatgaaatta
actcaatactctcacattacttttcaaagtcctctcgttttgaagtctaccggagaatac
gtagaagcctttcaagaggtattttaa

DBGET integrated database retrieval system