KEGG   Brucella melitensis bv. 1 16M: BMEI1926Help
Entry
BMEI1926          CDS       T00072                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA lyase
  KO
K01640  
hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Geraniol degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BMEI1926
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BMEI1926
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMEI1926
  Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    BMEI1926
Enzymes [BR:bme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     BMEI1926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:1984130..1984993
Genome map
AA seq 287 aa AA seqDB search
MAEHVEIVEMAARDGLQNEKRFVPTADKIALINRLSDCGYARIEATSFVSPKWVPQLADS
REVMAGIRRADGVRYSVLVPNMKGYEAAAAAHADEIAVFISASEGFSKANINCTIAESIE
RLSPVIGAAINDGLAIRGYVSCVVECPYDGPVTPQAVASVTEQLFSLGCHEVSLGDTIGR
GTPDTVAAMLDAVLAIAPAHSLAGHYHDTGGRALDNIRVSLEKGLRVFDASVGGLGGCPF
APGAKGNVDTVAVVEMLHEMGFETGLDLDRLRSAGLFTQALRQDKAA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacacgtggaaatcgttgaaatggctgcgcgtgatggcctgcaaaacgaaaag
cgttttgtgccgacagccgacaagatcgcgctgatcaaccgcctttcggattgcggctat
gcccgcatcgaggcgacgagcttcgtcagccccaaatgggtgccgcaactggcggatagc
cgggaagtcatggctggaatccgccgtgccgatggcgtgcgttattcggttctcgtgccc
aatatgaagggatatgaggcggcagcggcagcccatgcggatgaaatcgcggtttttatt
tccgcatccgaaggcttttccaaagccaatatcaattgcacgattgcggaaagtatcgag
cggctgtctccggtcatcggcgctgccatcaatgatggccttgccattcgcggctatgtg
agctgcgtggtggaatgcccttatgacgggccggttaccccacaggcggttgccagcgtg
accgagcaactcttctcgctcggctgtcatgaggtgagccttggcgacacgatcgggcgc
ggcacgccggacacggtagcagccatgctggatgccgtgctggcgattgcgcccgcgcac
agccttgccggccattatcacgacaccggcgggcgggcgctcgacaatatccgcgtcagt
ctggaaaaaggtctgcgcgtgttcgatgcttcggtcggcggtcttggcggctgtcccttc
gcgccgggcgccaagggtaatgtcgacacggtagcggtggtggaaatgctgcatgaaatg
ggttttgaaaccggcctcgatctggacaggcttcggtcggcgggtttgtttacacaagct
ttgcgtcaggataaagcggcatga

DBGET integrated database retrieval system