KEGG   Brucella melitensis bv. 1 16M: BMEII0251Help
Entry
BMEII0251         CDS       T00072                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00010  Glycolysis / Gluconeogenesis
bme00052  Galactose metabolism
bme00500  Starch and sucrose metabolism
bme00520  Amino sugar and nucleotide sugar metabolism
bme00521  Streptomycin biosynthesis
bme01100  Metabolic pathways
bme01110  Biosynthesis of secondary metabolites
bme01120  Microbial metabolism in diverse environments
bme01130  Biosynthesis of antibiotics
bme01200  Carbon metabolism
Module
bme_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMEII0251
   00052 Galactose metabolism
    BMEII0251
   00500 Starch and sucrose metabolism
    BMEII0251
   00520 Amino sugar and nucleotide sugar metabolism
    BMEII0251
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMEII0251
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BMEII0251
Enzymes [BR:bme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BMEII0251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AAL53492
UniProt: Q8YDC6
Position
II:complement(265092..266138)
Genome map
AA seq 348 aa AA seqDB search
MTGEDMQAIIDAEQSFKFPVLVGDIGGTNARFSILVDSNAEPKEFPVLQTADYATIDEAI
QHAILDQTAIQPRSVILAVAGPVDGDEIDLTNCDWVVRPKKMIADLGFEDVTVLNDFEAQ
ALAVVSLEGHHMEQIGGKPEEAVATRVVLGPGTGLGVAGLVCTRHAWVPVPGEGGHIDIG
PRTERDYQIFPHIERIEGRVTGEQILSGRGLRNLYLGICAADKITPTLETPVDITSAGLD
GSNPQAAETLDLFATYLGRLAGDLALIFMAHGGVYLSGGIPVRILSALKAGSFRAAFEDK
APNKAIMRDIPVRVITYQLAALTGLSAFARTPSRFEVSTEGRRWRMRR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacaggagaggacatgcaagcgattatcgacgccgaacagagtttcaagtttccggtt
ctcgtcggcgatatcggcggcaccaatgcccgtttttctatcctcgtggattcaaacgcg
gagccgaaggagtttcccgtgctccagacggcggattatgccacaatagacgaagcgatc
cagcacgccattctggatcagacggccatccagccgcgctctgtcattctggccgtggca
ggcccggtggacggcgacgagatcgacctcaccaattgcgactgggtcgtgcgtcctaaa
aagatgatcgctgatctgggctttgaagacgtgaccgtcctcaatgatttcgaggcgcag
gcccttgccgtggtttcgctggaaggccaccatatggaacagatcggcggcaaaccggag
gaggctgttgccacccgcgtcgtgctcggccccggcacgggccttggcgtggcaggtctg
gtttgcacacgtcatgcatgggttccggttcccggtgaaggcggtcatatcgatatcggt
ccacgcaccgaacgcgactaccagattttcccgcatatcgaacgcatcgaagggcgtgtc
accggcgagcaaattcttagcgggcggggcctgcgcaacctctatctgggcatctgcgcg
gccgacaagatcacgcccacccttgagacgccagtagacattacatccgccggactggac
ggcagcaatccacaagccgcagaaacgcttgacctcttcgccacctatctggggcggctt
gcgggcgaccttgcgctcattttcatggcgcatggcggcgtttatctttcgggtggcatc
ccggtgcgcatcctttccgccctcaaggccggttcgttccgcgcagccttcgaggacaag
gccccgaacaaggccatcatgcgcgacataccggtccgcgttatcacatatcaactggcg
gccttaaccgggctttccgctttcgcccgcaccccctcgcgctttgaagtttcgaccgag
ggccgccgctggcgcatgcgccgctag

DBGET integrated database retrieval system