KEGG   Brucella melitensis bv. 1 16M: BMEII0251Help
Entry
BMEII0251         CDS       T00072                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMEII0251 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMEII0251 (glk)
   00052 Galactose metabolism
    BMEII0251 (glk)
   00500 Starch and sucrose metabolism
    BMEII0251 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BMEII0251 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMEII0251 (glk)
   00524 Butirosin and neomycin biosynthesis
    BMEII0251 (glk)
Enzymes [BR:bme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BMEII0251 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(265092..266138)
Genome map
AA seq 348 aa AA seqDB search
MTGEDMQAIIDAEQSFKFPVLVGDIGGTNARFSILVDSNAEPKEFPVLQTADYATIDEAI
QHAILDQTAIQPRSVILAVAGPVDGDEIDLTNCDWVVRPKKMIADLGFEDVTVLNDFEAQ
ALAVVSLEGHHMEQIGGKPEEAVATRVVLGPGTGLGVAGLVCTRHAWVPVPGEGGHIDIG
PRTERDYQIFPHIERIEGRVTGEQILSGRGLRNLYLGICAADKITPTLETPVDITSAGLD
GSNPQAAETLDLFATYLGRLAGDLALIFMAHGGVYLSGGIPVRILSALKAGSFRAAFEDK
APNKAIMRDIPVRVITYQLAALTGLSAFARTPSRFEVSTEGRRWRMRR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacaggagaggacatgcaagcgattatcgacgccgaacagagtttcaagtttccggtt
ctcgtcggcgatatcggcggcaccaatgcccgtttttctatcctcgtggattcaaacgcg
gagccgaaggagtttcccgtgctccagacggcggattatgccacaatagacgaagcgatc
cagcacgccattctggatcagacggccatccagccgcgctctgtcattctggccgtggca
ggcccggtggacggcgacgagatcgacctcaccaattgcgactgggtcgtgcgtcctaaa
aagatgatcgctgatctgggctttgaagacgtgaccgtcctcaatgatttcgaggcgcag
gcccttgccgtggtttcgctggaaggccaccatatggaacagatcggcggcaaaccggag
gaggctgttgccacccgcgtcgtgctcggccccggcacgggccttggcgtggcaggtctg
gtttgcacacgtcatgcatgggttccggttcccggtgaaggcggtcatatcgatatcggt
ccacgcaccgaacgcgactaccagattttcccgcatatcgaacgcatcgaagggcgtgtc
accggcgagcaaattcttagcgggcggggcctgcgcaacctctatctgggcatctgcgcg
gccgacaagatcacgcccacccttgagacgccagtagacattacatccgccggactggac
ggcagcaatccacaagccgcagaaacgcttgacctcttcgccacctatctggggcggctt
gcgggcgaccttgcgctcattttcatggcgcatggcggcgtttatctttcgggtggcatc
ccggtgcgcatcctttccgccctcaaggccggttcgttccgcgcagccttcgaggacaag
gccccgaacaaggccatcatgcgcgacataccggtccgcgttatcacatatcaactggcg
gccttaaccgggctttccgctttcgcccgcaccccctcgcgctttgaagtttcgaccgag
ggccgccgctggcgcatgcgccgctag

DBGET integrated database retrieval system