KEGG   Bacillus megaterium WSH-002: BMWSH_4679Help
Entry
BMWSH_4679        CDS       T01890                                 

Gene name
gpm
Definition
Phosphoglycerate mutase 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMWSH_4679 (gpm)
   01230 Biosynthesis of amino acids
    BMWSH_4679 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMWSH_4679 (gpm)
  Energy metabolism
   00680 Methane metabolism
    BMWSH_4679 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMWSH_4679 (gpm)
Enzymes [BR:bmh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BMWSH_4679 (gpm)
Exosome [BR:bmh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BMWSH_4679 (gpm)
  Exosomal proteins of melanoma cells
   BMWSH_4679 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4452477..4453202
Genome map
AA seq 241 aa AA seqDB search
MIKLVLIRHGQSVWNLENKFTGWTDVDLSKNGLQEAREAGKVLKKNEYTFDIAYTSVLKR
SIRTLWIILHQMDFMWIPVYKSWRLNERHYGALQGLNKEETAKKFGEEQVHLWRRSMNER
PPALKTTDIRYEASNPKYKELAKGQFPVTENLADTEKRVLEYWNETIAPSIKAGKRVIIS
AHGNTIRALMQYLDNISPDGIANLNIPTSVPLVYELDDNLKPIRHYYLGIDGEIPTHIPS
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtgttgattcggcacggacaaagcgtgtggaatcttgaaaataaattt
acaggctggacggatgtagatctttctaaaaatggattgcaagaagcgcgagaagctgga
aaagtgctaaagaaaaacgaatatacttttgatattgcctatacttctgttttaaaacga
tccattcgcactctatggattatcttacatcaaatggacttcatgtggattcctgtatac
aaatcttggaggttgaatgaacgacactacggagctcttcaaggtttgaacaaagaagaa
accgcaaaaaaatttggcgaagagcaagtacatttgtggagaaggtcgatgaacgaacgc
cctcctgctttaaagacaacagatattcgctatgaagcttccaaccctaagtataaggaa
ttagctaagggacaatttcctgtaacggaaaacttagctgatacagaaaagcgggttcta
gaatattggaacgaaactattgctccttctattaaagctggcaaaagagttattatttcc
gctcacggtaatacgattagagctctgatgcagtatttggataacatttcacctgatggc
attgcgaacttgaatattcccacaagtgtgccgcttgtgtatgagcttgatgataattta
aagcccattagacattattacttaggcatcgacggagagattcctacacatattccttct
tcataa

DBGET integrated database retrieval system