KEGG   Brucella melitensis ATCC 23457: BMEA_A0041Help
Entry
BMEA_A0041        CDS       T00867                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
bmi  Brucella melitensis ATCC 23457
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bmi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BMEA_A0041
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMEA_A0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:44287..44895
Genome map
AA seq 202 aa AA seqDB search
MNSTRNNKFIMAFLATVFVVMTTGILSDSLFHSPAPEKPGFAIEVAQGSGGGESAAPPAK
EEVSIATLLQSADPARGEVVFKRCQACHTGDKGGANKVGPHLWGVVGRPAASVEGFSYSA
AMKEFGAAGNKWDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSDNPVP
LPAADAAPADSDKKPAEAAPAN
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaacccggaataacaaatttattatggcatttctggcaacggttttcgttgtc
atgacgacgggcattctgtctgattcgctgtttcattcgccggctcctgaaaagccgggc
tttgccatagaggtagcccaaggttcggggggcggagaaagtgctgcgcctcccgccaag
gaagaagtttcaattgcaaccctgttgcaaagtgccgatccggcgcgtggcgaagtggtt
ttcaagcgttgccaggcttgccacaccggggacaagggcggggccaacaaggttggtccg
catctgtggggtgtcgtgggtcgcccggctgcctccgttgaaggtttcagctattccgct
gccatgaaggaattcggcgcggctggcaacaagtgggattttgagcatctcaacaagttc
ctcacctcgccgaaaggcttcatcaagggtacagccatgggctttgccggtgacaagaag
gataatgagcgcgctgacctgattgcttatctgcgcacgctgtccgacaatccggtgccg
ctgccggccgcagacgcagcgcccgcagatagcgataaaaagcccgccgaagctgcaccg
gccaattga

DBGET integrated database retrieval system