KEGG   Bacillus megaterium QM B1551: BMQ_2117Help
Entry
BMQ_2117          CDS       T01208                                 

Gene name
gtaB
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
bmq00040  Pentose and glucuronate interconversions
bmq00052  Galactose metabolism
bmq00500  Starch and sucrose metabolism
bmq00520  Amino sugar and nucleotide sugar metabolism
bmq01100  Metabolic pathways
bmq01130  Biosynthesis of antibiotics
Module
bmq_M00362  Nucleotide sugar biosynthesis, prokaryotes
bmq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMQ_2117 (gtaB)
   00052 Galactose metabolism
    BMQ_2117 (gtaB)
   00500 Starch and sucrose metabolism
    BMQ_2117 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BMQ_2117 (gtaB)
Enzymes [BR:bmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BMQ_2117 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Exo70 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: ADE69146
UniProt: D5DQZ6
Position
2121089..2121976
Genome map
AA seq 295 aa AA seqDB search
MTIKKAVIPVGGLGTRFLPATKAQPKEMLPIVDKPAVQYIVEEAVKSGIESIIFITGRNK
KSIEDHFDKSIELEQMLEEKHKFDMLKEVQTISSMASIHYIRQKEPLGLGHAILCAEQFI
GDEPFAVLLGDDIMTSEEPALKQMIQAYETTNQSVIGVQKVDVEEVSKYGIIQPKNKSGS
LHEVSDLIEKPSIEQAPSTIAVMGRYILNPSIFSYLKTIERGVGNELQLTDALRVVCEKE
RLFALELEGQRFDIGDKIGYMKAMVEVALKRKDLRQTFLSYLEGIVEKERANNFS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacgataaaaaaagcagttattccagtaggcggtttaggaactcgatttttgccagcg
acaaaagcgcagccgaaagaaatgctgccaattgtcgataagcctgctgtacaatatatt
gtagaagaagctgtgaaatcaggcattgaaagtattatttttattacaggacgaaacaaa
aaatcaattgaagaccattttgataaatcaattgagttagagcaaatgcttgaagaaaaa
cacaagtttgacatgttaaaagaagtacaaacgatctcatcaatggccagcattcactat
attcgtcaaaaagagccgttaggactcggtcatgctattctttgtgccgagcagtttatt
ggagatgagccgtttgccgttcttcttggagatgatattatgacttctgaagaacctgcg
ctcaaacagatgatccaagcgtatgaaacgactaatcaatcagttatcggagttcaaaaa
gtggatgttgaagaggtatcgaaatacggaatcattcagccaaaaaataaatccggcagc
cttcatgaagtgagtgacttgatcgaaaaaccatcgatagaacaagctccgtcaactatt
gccgttatgggccgctacattttaaacccttctattttttcttatctaaaaaccattgaa
agaggggtaggaaatgaattacaattaacagatgcactgcgtgtagtatgtgaaaaagag
cggctgtttgctcttgaactggaaggacagcgctttgacattggagataagataggctat
atgaaagcaatggtagaagtggcgttaaagcgtaaagatttacgtcaaacgtttttatcg
tatttggaaggaattgtagaaaaagaacgagcaaacaacttcagctaa

DBGET integrated database retrieval system