KEGG   Bacillus megaterium QM B1551: BMQ_2117Help
Entry
BMQ_2117          CDS       T01208                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bmq  Bacillus megaterium QM B1551
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMQ_2117 (gtaB)
   00052 Galactose metabolism
    BMQ_2117 (gtaB)
   00500 Starch and sucrose metabolism
    BMQ_2117 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BMQ_2117 (gtaB)
Enzymes [BR:bmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BMQ_2117 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2121089..2121976
Genome map
AA seq 295 aa AA seqDB search
MTIKKAVIPVGGLGTRFLPATKAQPKEMLPIVDKPAVQYIVEEAVKSGIESIIFITGRNK
KSIEDHFDKSIELEQMLEEKHKFDMLKEVQTISSMASIHYIRQKEPLGLGHAILCAEQFI
GDEPFAVLLGDDIMTSEEPALKQMIQAYETTNQSVIGVQKVDVEEVSKYGIIQPKNKSGS
LHEVSDLIEKPSIEQAPSTIAVMGRYILNPSIFSYLKTIERGVGNELQLTDALRVVCEKE
RLFALELEGQRFDIGDKIGYMKAMVEVALKRKDLRQTFLSYLEGIVEKERANNFS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacgataaaaaaagcagttattccagtaggcggtttaggaactcgatttttgccagcg
acaaaagcgcagccgaaagaaatgctgccaattgtcgataagcctgctgtacaatatatt
gtagaagaagctgtgaaatcaggcattgaaagtattatttttattacaggacgaaacaaa
aaatcaattgaagaccattttgataaatcaattgagttagagcaaatgcttgaagaaaaa
cacaagtttgacatgttaaaagaagtacaaacgatctcatcaatggccagcattcactat
attcgtcaaaaagagccgttaggactcggtcatgctattctttgtgccgagcagtttatt
ggagatgagccgtttgccgttcttcttggagatgatattatgacttctgaagaacctgcg
ctcaaacagatgatccaagcgtatgaaacgactaatcaatcagttatcggagttcaaaaa
gtggatgttgaagaggtatcgaaatacggaatcattcagccaaaaaataaatccggcagc
cttcatgaagtgagtgacttgatcgaaaaaccatcgatagaacaagctccgtcaactatt
gccgttatgggccgctacattttaaacccttctattttttcttatctaaaaaccattgaa
agaggggtaggaaatgaattacaattaacagatgcactgcgtgtagtatgtgaaaaagag
cggctgtttgctcttgaactggaaggacagcgctttgacattggagataagataggctat
atgaaagcaatggtagaagtggcgttaaagcgtaaagatttacgtcaaacgtttttatcg
tatttggaaggaattgtagaaaaagaacgagcaaacaacttcagctaa

DBGET integrated database retrieval system