KEGG   Burkholderia multivorans ATCC 17616 (JGI): Bmul_0517Help
Entry
Bmul_0517         CDS       T00624                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bmu  Burkholderia multivorans ATCC 17616 (JGI)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bmu03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:566333..567160
Genome map
AA seq 275 aa AA seqDB search
MPELPEVEVTRRGIAPFVAGRRVERVDVRTAMLRWPVPAGLAEQLRAREVLAVERRGKYL
LFEVDAGWFIVHLGMTGTLRVLPAGGVPVAAKHDHIDWIFDEFVLRFRDPRRFGAVLWHS
REAGDVHAHPLLASLGVEPFSPAFDGALLHRRTRGRTVSVKQALLAGDIVVGVGNIYASE
SLFRAGIRPTTAAGKVSLPRYERLAEAVRATLADAIDRGGSTLRDFVGSNGESGYFQLDC
FVYDRAGEPCRVCGTPIRQIVQGQRSTYFCPTCQR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccagagttgccagaagtcgaagtcacgcggcggggcattgcgccctttgtcgcgggc
cgccgcgtcgagcgtgtcgacgtccgcaccgcgatgctgcgctggcccgtgccggccggg
ctcgcggagcaattgcgcgcgcgcgaggtgctcgccgtcgagcgtcgcggcaagtatctg
ctgttcgaggtcgatgcgggctggttcatcgtccatctcggcatgacgggcacgctgcgc
gtgctgcccgcaggcggcgtgcccgtcgccgcgaagcacgatcacatcgactggatcttc
gacgaattcgtgctgcgctttcgcgatccgcgccggttcggcgccgtgctgtggcattcg
cgcgaagcgggcgacgtgcatgcgcatccgctgctcgccagcctcggcgtcgagccgttt
tcgccggcattcgacggcgcgctgctgcatcggcgcacgcgcggccgcacggtgtccgtc
aagcaggcgctgctcgcgggcgacatcgtggtcggcgtcggcaacatctacgcgtcggag
agcctgtttcgcgcaggcatccggccgacgacggccgccggcaaggtatcgctgccgcgc
tacgagcggctcgccgaagcggtgcgcgcgacgctcgcggacgcgatcgaccgcggcggc
agcacgctgcgcgatttcgtcggcagcaacggcgagagcggctacttccagctcgactgc
ttcgtctacgatcgcgcgggcgagccgtgccgcgtgtgcggcacgccgatccggcagatc
gtgcagggccagcgctcgacttacttctgtccgacgtgccagcgttga

DBGET integrated database retrieval system