KEGG   Burkholderia mallei SAVP1: BMASAVP1_1651Help
Entry
BMASAVP1_1651     CDS       T00457                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bmv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BMASAVP1_1651 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMASAVP1_1651 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMASAVP1_1651 (trpA)
Enzymes [BR:bmv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BMASAVP1_1651 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
UniProt: 
Position
II:1618351..1619166
Genome map
AA seq 271 aa AA seqDB search
MSRIQNTFAALAAQGRKGLIPFITAGDPDPAKTVELMHALAEGGADVIELGVPFSDPMAD
GPVIQRSSERALAKGVTLHSVLDDVKRFRARDQKTPVVLMGYANPIERMGADAFAAAARD
AGVDGVLVVDYPPEESHDFAAKMRAAGIDPIFLLAPTSTDDRIAAVGQVASGYVYYVSLK
GVTGAANLDVSSIAGKIPAIKSRVPLPVGVGFGIRDAATARAVAEVADAVVIGSRLVQLL
EQAVPERAAAELAGFVAELRAAIDGAAKPAA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtattcagaacacttttgccgcactcgccgcccaaggtcgcaaggggctgatt
ccgttcatcaccgcgggagacccggacccggcgaagaccgtcgagctgatgcacgcgctc
gccgaaggcggcgccgacgtgatcgagctcggcgtgccgttctccgacccgatggccgac
ggccccgtgatccagcgctcgtcggagcgcgcgctcgcgaaaggcgtgacgcttcacagc
gtgctcgacgacgtgaagcgctttcgcgcgcgcgaccagaagacgcccgtcgtgctgatg
ggctacgcgaatccgatcgagcgcatgggcgcggacgcattcgccgcggccgcgcgcgac
gcgggcgtcgacggcgtgctcgtcgttgactatccgcccgaggaatcgcacgatttcgcc
gcgaagatgcgcgcggcgggcatcgatccgatcttcctgctcgcgccgacgtcgaccgac
gaccggatcgccgccgtcggccaggtggcgagcggctacgtctactatgtgtcgctcaag
ggggtgacgggcgccgcaaatctggatgtttccagcattgcgggtaaaatcccggccatc
aagtcgcgcgtgccgcttcccgtcggggtcggtttcggcatccgcgacgccgcgacggcg
cgcgcggtggccgaggtggcggacgccgtcgtgatcggcagccgccttgtccagctgctg
gagcaggccgtgccggagcgggccgccgccgagctcgcggggttcgtcgccgagctgcgc
gccgcgatcgacggcgcggcgaagccggcggcatga

DBGET integrated database retrieval system