KEGG   Burkholderia mallei SAVP1: BMASAVP1_A1613Help
Entry
BMASAVP1_A1613    CDS       T00457                                 

Definition
magnesium chelatase subunit ChII
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bmv  Burkholderia mallei SAVP1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bmv00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(1587033..1588316)
Genome map
AA seq 427 aa AA seqDB search
MNPTNEAGAATAAASDDRALPAAYPFSALIGQAALQQALLLVAVDPGLGGVLVSGPRGTA
KSTAARALAELLPEGRFVTLPLSASDEQVTGSLDLASALADNTVRFSPGLVARAHLGVLY
VDEINLLPDALVDALLDAAASGVNTVERDGVSHSHAARFALVGTMNPEEGELRPQLLDRF
GLMVELANCYDAATRQRIVKARLAFDLDPHGFRAQYRDAQAALVAQIRAARAALPALAFD
DAAHARVAELCIGAAVDGLRGDLVMLRAARALAALDGAARVAAAHVERVAADVLRHRRTR
FEPQPEFQPGFQPGSQAGPQPMGRREPPPASRSAGGDAPGGRADPGEAEATRAPTPRDAL
PGGASGPAHPAARAPSDAQRRAADERAAARDGGRGPAADDSDWGYLPPEPAGIAPVKGVI
PLPLKKR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttgaacccaacgaacgaagccggcgcggcaacggccgccgcctccgacgaccgcgcattg
ccggccgcctatccgttttccgcgctgatcggccaggcggcgttgcagcaggcgctgctg
ctcgtcgccgtcgatccgggcctgggcggcgtgctcgtgagcggcccgcgcggcaccgcg
aaatcgaccgccgcgcgcgcgctcgccgagctgctgcccgaggggcgcttcgtcacgctg
ccgctgtcggccagcgacgagcaggtgacgggttcgctcgacctcgcgagcgcgctcgcc
gacaatacggtgcgcttttcgcccggcctcgtcgcgcgcgcgcatctcggcgtgctgtac
gtcgacgagatcaacctgctgccggacgcgctcgtcgacgcgttgctcgacgcggccgcg
agcggcgtcaacacggtcgagcgcgacggcgtgtcgcacagccacgcggcgcgcttcgcg
ctcgtcggcacgatgaacccggaagagggcgagttgcgcccgcaactgctcgaccgtttc
gggctgatggtggagctcgcgaactgctacgacgcggcgacgcggcagcggatcgtcaag
gcgcggctcgcgttcgatctcgatccgcacggctttcgcgcgcagtaccgcgacgcgcag
gcggcgctcgtcgcgcaaattcgcgcggcgcgcgccgcgctgccggcgctcgcgttcgac
gacgccgcgcacgcgcgcgtcgccgagctgtgcatcggcgcggccgtcgacggcctgcgc
ggcgacctcgtgatgctgcgcgccgcgcgggcgctcgcggcgctcgacggggcggcgcgc
gtcgccgcggcgcacgtcgagcgcgtcgccgccgatgtgctgcgccatcggcgcacgcgg
ttcgagccgcaacctgaatttcagcccggatttcaacccgggtctcaagccgggcctcag
ccgatggggcgacgcgagcctccgcccgcatcgcgttcggccggcggcgacgcgccgggc
gggcgcgcggatccgggcgaagccgaagccacgcgcgcgcccacgcctcgcgacgcgctg
cccggcggcgcgagcggaccggcgcatcccgctgcgcgcgcgccgtccgacgcgcagcgg
cgcgcggcggacgagcgcgccgcggcgcgcgacggcggccgtgggccggccgccgacgat
agcgactggggctatctgccgcccgagccggcgggcatcgcgcccgtcaagggcgtgatc
ccgctgccgctaaaaaaacgctga

DBGET integrated database retrieval system